KEGG   Homo sapiens (human): 5224Help
Entry
5224              CDS       T01001                                 

Gene name
PGAM2, GSD10, PGAM-M, PGAMM
Definition
(RefSeq) phosphoglycerate mutase 2 (muscle) (EC:3.1.3.13 5.4.2.4 5.4.2.11)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Disease
H00069  
Glycogen storage diseases (GSD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    5224 (PGAM2)
   01230 Biosynthesis of amino acids
    5224 (PGAM2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5224 (PGAM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    5224 (PGAM2)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    5224 (PGAM2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    5224 (PGAM2)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     5224 (PGAM2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   5224 (PGAM2)
  Exosomal proteins of melanoma cells
   5224 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
7p13-p12
AA seq 253 aa AA seqDB search
MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVL
KRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
IPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKR
VLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELNKELKPTKPMQFLGDEETVR
KAMEAVAAQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccactcaccgcctcgtgatggtccggcacggcgagagcacatggaaccaggagaac
cgtttctgtggctggttcgatgcagagctgagtgaaaaggggaccgaggaggccaagcgg
ggagccaaggccatcaaggatgccaagatggagtttgacatctgctacacgtcagtgctg
aagcgggccatccgcaccctctgggccatcctggacggcacggaccagatgtggctgcct
gtggtgcgcacttggcgcctcaatgagcggcattacgggggcctcacaggcctcaacaag
gcagaaacggccgccaagcacggggaggagcaggtgaagatctggaggcgctccttcgac
atcccgccgcccccgatggacgagaagcacccctactacaactccattagcaaggagcgt
cggtacgcaggcctgaagcccggggaactccccacctgcgagagcctcaaggacaccatt
gcccgggccctgcccttctggaacgaggagattgttccccagatcaaggccggcaagcga
gtgctcattgcagcccacgggaacagcctgcggggcattgtcaagcacctggaagggatg
tcagaccaggcgatcatggagctgaacctgcccacggggatccccattgtgtatgagctg
aacaaggagctgaagcccaccaagcccatgcagttcctgggtgatgaggaaacggtgcgg
aaggccatggaggctgtggctgcccagggcaaggccaagtga

DBGET integrated database retrieval system