KEGG   Homo sapiens (human): 5257Help
Entry
5257              CDS       T01001                                 

Gene name
PHKB
Definition
phosphorylase kinase, beta (EC:2.7.11.19)
Orthology
K07190  
phosphorylase kinase alpha/beta subunit
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Insulin signaling pathway
Disease
H00069  
Glycogen storage diseases (GSD)
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
16q12-q13
AA seq 1093 aa AA seqDB search
MAGAAGLTAEVSWKVLERRARTKRSGSVYEPLKSINLPRPDNETLWDKLDHYYRIVKSTL
LLYQSPTTGLFPTKTCGGDQKAKIQDSLYCAAGAWALALAYRRIDDDKGRTHELEHSAIK
CMRGILYCYMRQADKVQQFKQDPRPTTCLHSVFNVHTGDELLSYEEYGHLQINAVSLYLL
YLVEMISSGLQIIYNTDEVSFIQNLVFCVERVYRVPDFGVWERGSKYNNGSTELHSSSVG
LAKAALEAINGFNLFGNQGCSWSVIFVDLDAHNRNRQTLCSLLPRESRSHNTDAALLPCI
SYPAFALDDEVLFSQTLDKVVRKLKGKYGFKRFLRDGYRTSLEDPNRCYYKPAEIKLFDG
IECEFPIFFLYMMIDGVFRGNPKQVQEYQDLLTPVLHHTTEGYPVVPKYYYVPADFVEYE
KNNPGSQKRFPSNCGRDGKLFLWGQALYIIAKLLADELISPKDIDPVQRYVPLKDQRNVS
MRFSNQGPLENDLVVHVALIAESQRLQVFLNTYGIQTQTPQQVEPIQIWPQQELVKAYLQ
LGINEKLGLSGRPDRPIGCLGTSKIYRILGKTVVCYPIIFDLSDFYMSQDVFLLIDDIKN
ALQFIKQYWKMHGRPLFLVLIREDNIRGSRFNPILDMLAALKKGIIGGVKVHVDRLQTLI
SGAVVEQLDFLRISDTEELPEFKSFEELEPPKHSKVKRQSSTPSAPELGQQPDVNISEWK
DKPTHEILQKLNDCSCLASQAILLGILLKREGPNFITKEGTVSDHIERVYRRAGSQKLWL
AVRYGAAFTQKFSSSIAPHITTFLVHGKQVTLGAFGHEEEVISNPLSPRVIQNIIYYKCN
THDEREAVIQQELVIHIGWIISNNPELFSGMLKIRIGWIIHAMEYELQIRGGDKPALDLY
QLSPSEVKQLLLDILQPQQNGRCWLNRRQIDGSLNRTPTGFYDRVWQILERTPNGIIVAG
KHLPQQPTLSDMTMYEMNFSLLVEDTLGNIDQPQYRQIVVELLMVVSIVLERNPELEFQD
KVDLDRLVKEAFNEFQKDQSRLKEIEKQDDMTSFYNTPPLGKRGTCSYLTKAVMNLLLEG
EVKPNNDDPCLIS
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggcggcgggactcacggcagaagtgagctggaaggtcttggagcgaagagct
cggaccaagcgctcaggctcagtttatgaacctcttaaaagcattaatcttccaagacct
gataatgaaactctctgggataagttggaccattattacagaattgtcaagtcaacattg
ctgctgtatcaaagtccaactaccggtctctttcccactaaaacatgcggtggtgaccag
aaggccaagatccaggacagcctatactgcgctgctggggcctgggctttggctcttgca
tacaggcgaattgatgatgacaagggaaggacccatgagctggagcactcagctataaaa
tgcatgagaggaattctctactgctatatgcgtcaggccgataaggtccagcagtttaag
caggatccacgcccaacaacatgtcttcactctgttttcaatgtgcatacaggagatgag
ttgctttcctatgaggaatatggtcatcttcagataaatgcagtgtcactttatctcctt
taccttgtggaaatgatttcctcaggactccagattatctacaacactgatgaggtctct
tttattcaaaaccttgtattttgtgtggaaagagtttaccgtgtgcctgactttggtgtc
tgggaaagaggaagcaaatataataatggcagcacagagctacattcgagctcggttggt
ttagcaaaagcagctctagaagcaattaatggattcaacctttttggcaaccagggctgt
tcgtggtcagttatatttgtggatctcgatgctcacaatcgcaacaggcaaactttgtgc
tcgctgttacccagagaatcaagatcacataatacagatgctgccctgctcccctgcatc
agttatcctgcatttgccctggatgatgaagttctttttagccagacacttgataaagtg
gttagaaaattaaaaggaaaatatggatttaaacgtttcttgagagatgggtatagaaca
tcattggaagatcccaacagatgctactacaagccagctgaaattaagctatttgatggc
attgaatgtgaatttcccatatttttcctttatatgatgattgatggagtttttagaggc
aatcctaagcaagtacaggaatatcaggatcttttgactccagtacttcatcataccaca
gaaggatatcctgttgtaccaaagtactattatgtgccagctgactttgtagaatatgaa
aaaaataaccctggtagtcaaaaacgatttcctagcaactgtggccgtgatggaaaactg
tttctttggggacaagcactttatatcatcgcaaaactcctggctgatgaacttattagt
cctaaagacattgatcctgtccagcgctatgtcccactaaaggatcaacgtaacgtgagc
atgaggttttccaatcagggcccactggaaaatgacttggtagttcatgtggcacttata
gcagaaagccaaagacttcaagtttttctgaacacatatggtattcaaactcaaactcct
caacaagtagaacccattcagatatggcctcagcaggagcttgtgaaagcttatttgcag
ctgggtatcaatgaaaagttaggactctctggaaggccagacaggcccattggctgcctc
gggacatcaaagatttatcgcattctaggaaagactgtggtttgttacccgattattttc
gacctaagtgatttctacatgtctcaggatgttttcctgctgatagatgacataaagaat
gcgctgcagttcattaaacaatattggaaaatgcatggacgtccacttttccttgttctc
atccgggaagacaatataagaggtagccggttcaaccccatattagatatgctggcagcc
cttaaaaaaggaataattggaggagtcaaagttcatgtggatcgtctacagacactaata
tctggagctgtggtagaacaacttgatttcctacgaatcagtgacacagaagagcttcca
gaatttaagagttttgaggaactagaacctcccaaacattcaaaagtcaaacggcaaagc
agcacccctagtgctcctgaactgggacagcagccggatgtcaacattagtgaatggaag
gacaaacccacccacgaaattcttcaaaaactgaatgattgcagttgtctggctagccaa
gccatcctgctgggtatactgctcaaaagagaaggccccaacttcatcacaaaggaaggt
accgtttctgatcacattgagagagtctatagaagagctggcagccaaaaactttggttg
gcggtgcgctacggggctgcatttacccagaaattttcttcctctatagccccacacatt
actacttttctggtacatgggaaacaggtaactctgggtgcctttgggcatgaagaagaa
gttatctctaatcctttgtctccaagagtgattcaaaacatcatctattataagtgtaac
acccatgatgagagggaagcggtcattcagcaagaactggtcatccatattggctggatc
atctccaataaccctgagttattcagtggcatgctgaaaatacgaatcgggtggatcatc
catgccatggagtatgaacttcagatccgtggcggagacaagccagccttggacttgtat
cagctgtcacctagtgaagttaaacagcttctgctggatattctgcagcctcaacagaat
ggaagatgttggctgaacaggcgtcagatcgatgggtctttgaatagaactcccaccggg
ttctatgaccgagtgtggcagattctggagcgcacgcccaatgggatcattgttgctggg
aagcatttgcctcagcaaccaaccctgtcagatatgaccatgtatgagatgaatttctct
ctccttgttgaagacacgttgggaaatattgaccagccacagtacagacagatcgttgta
gagttacttatggttgtatccattgtactggaaagaaaccccgagctagaatttcaagac
aaagtagatctagacagactggtcaaagaagcatttaatgaatttcaaaaagatcagagt
cggctaaaggaaattgaaaaacaagatgacatgacttccttttacaacactcctcccctg
ggaaaaagaggaacatgcagctatttgacaaaggcggtgatgaatctgctgctggaagga
gaagtcaagccaaacaatgatgacccgtgtctgattagctag

DBGET integrated database retrieval system