KEGG   Homo sapiens (human): 5265Help
Entry
5265              CDS       T01001                                 

Gene name
SERPINA1, A1A, A1AT, AAT, PI, PI1, PRO2275, alpha1AT
Definition
serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Orthology
K03984  
alpha-1-antitrypsin
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Disease
H01103  
Alpha-1-antitrypsin (A1AT) deficiency
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
14q32.1
AA seq 418 aa AA seqDB search
MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFS
LYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGF
QELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQ
INDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTV
KVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFL
ENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKA
VLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcttctgtctcgtggggcatcctcctgctggcaggcctgtgctgcctggtccct
gtctccctggctgaggatccccagggagatgctgcccagaagacagatacatcccaccat
gatcaggatcacccaaccttcaacaagatcacccccaacctggctgagttcgccttcagc
ctataccgccagctggcacaccagtccaacagcaccaatatcttcttctccccagtgagc
atcgctacagcctttgcaatgctctccctggggaccaaggctgacactcacgatgaaatc
ctggagggcctgaatttcaacctcacggagattccggaggctcagatccatgaaggcttc
caggaactcctccgtaccctcaaccagccagacagccagctccagctgaccaccggcaat
ggcctgttcctcagcgagggcctgaagctagtggataagtttttggaggatgttaaaaag
ttgtaccactcagaagccttcactgtcaacttcggggacaccgaagaggccaagaaacag
atcaacgattacgtggagaagggtactcaagggaaaattgtggatttggtcaaggagctt
gacagagacacagtttttgctctggtgaattacatcttctttaaaggcaaatgggagaga
ccctttgaagtcaaggacaccgaggaagaggacttccacgtggaccaggtgaccaccgtg
aaggtgcctatgatgaagcgtttaggcatgtttaacatccagcactgtaagaagctgtcc
agctgggtgctgctgatgaaatacctgggcaatgccaccgccatcttcttcctgcctgat
gaggggaaactacagcacctggaaaatgaactcacccacgatatcatcaccaagttcctg
gaaaatgaagacagaaggtctgccagcttacatttacccaaactgtccattactggaacc
tatgatctgaagagcgtcctgggtcaactgggcatcactaaggtcttcagcaatggggct
gacctctccggggtcacagaggaggcacccctgaagctctccaaggccgtgcataaggct
gtgctgaccatcgacgagaaagggactgaagctgctggggccatgtttttagaggccata
cccatgtctatcccccccgaggtcaagttcaacaaaccctttgtcttcttaatgattgaa
caaaataccaagtctcccctcttcatgggaaaagtggtgaatcccacccaaaaataa

DBGET integrated database retrieval system