KEGG   Homo sapiens (human): 5308Help
Entry
5308              CDS       T01001                                 

Gene name
PITX2, ARP1, Brx1, IDG2, IGDS, IGDS2, IHG2, IRID2, Otlx2, PTX2, RGS, RIEG, RIEG1, RS
Definition
paired-like homeodomain 2
Orthology
K04686  
paired-like homeodomain transcription factor 2
Organism
hsa  Homo sapiens (human)
Pathway
TGF-beta signaling pathway
Disease
H00620  
Axenfeld-Rieger syndrome (ARS)
H01075  
Peters anomaly
H01149  
Ring dermoid of cornea
H01159  
Anterior segment dysgenesis (ASD)
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4q25
AA seq 324 aa AA seqDB search
MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTIS
DTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMS
TREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPG
YSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTG
VPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSS
FGYASVQNPASNLSACQYAVDRPV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaactgcatgaaaggcccgcttcacttggagcaccgagcagcggggaccaagctgtcg
gccgtctcctcatcttcctgtcaccatccccagccgttagccatggcttcggttctggct
cccggtcagccccggtcgctggactcctccaagcacaggctggaggtgcacaccatctcc
gacacctccagcccggaggccgcagagaaagataaaagccagcaggggaagaatgaggac
gtgggcgccgaggacccgtctaagaagaagcggcaaaggcggcagcggactcactttacc
agccagcagctccaggagctggaggccactttccagaggaaccgctacccggacatgtcc
acacgcgaagaaatcgctgtgtggaccaaccttacggaagcccgagtccgggtttggttc
aagaatcgtcgggccaaatggagaaagagggagcgcaaccagcaggccgagctatgcaag
aatggcttcgggccgcagttcaatgggctcatgcagccctacgacgacatgtacccaggc
tattcctacaacaactgggccgccaagggccttacatccgcctccctatccaccaagagc
ttccccttcttcaactctatgaacgtcaaccccctgtcatcacagagcatgttttcccca
cccaactctatctcgtccatgagcatgtcgtccagcatggtgccctcagcagtgacaggc
gtcccgggctccagtctcaacagcctgaataacttgaacaacctgagtagcccgtcgctg
aattccgcggtgccgacgcctgcctgtccttacgcgccgccgactcctccgtatgtttat
agggacacgtgtaactcgagcctggccagcctgagactgaaagcaaagcagcactccagc
ttcggctacgccagcgtgcagaacccggcctccaacctgagtgcttgccagtatgcagtg
gaccggcccgtgtga

DBGET integrated database retrieval system