KEGG   Homo sapiens (human): 5313Help
Entry
5313              CDS       T01001                                 

Gene name
PKLR, PK1, PKL, PKR, PKRL, RPK
Definition
pyruvate kinase, liver and RBC (EC:2.7.1.40)
Orthology
K12406  
pyruvate kinase isozymes R/L [EC:2.7.1.40]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Insulin signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Maturity onset diabetes of the young
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Disease
H01096  
Pyruvate kinase (PK) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    5313 (PKLR)
   01230 Biosynthesis of amino acids
    5313 (PKLR)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5313 (PKLR)
   00620 Pyruvate metabolism
    5313 (PKLR)
  Nucleotide metabolism
   00230 Purine metabolism
    5313 (PKLR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5313 (PKLR)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    5313 (PKLR)
   04950 Maturity onset diabetes of the young
    5313 (PKLR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5313 (PKLR)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     5313 (PKLR)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5313 (PKLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1q21
AA seq 574 aa AA seqDB search
MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQ
LPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFS
HGSHEYHAESIANVREAVESFAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKG
SQVLVTVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQV
ENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGVDIVFASFVRKASDVAAVRAA
LGPEGHGIKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRC
NLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGETAKGNFPVEAVKM
QHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRS
AQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESG
KLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccaggagaacatatcatccctgcagcttcggtcatgggtctctaagtcccaa
agagacttagcaaagtccatcctgattggggctccaggagggccagcggggtatctgcgg
cgggccagtgtggcccaactgacccaggagctgggcactgccttcttccagcagcagcag
ctgccagctgctatggcagacaccttcctggaacacctctgcctactggacattgactcc
gagcccgtggctgctcgcagtaccagcatcattgccaccatcgggccagcatctcgctcc
gtggagcgcctcaaggagatgatcaaggccgggatgaacattgcgcgactcaacttctcc
cacggctcccacgagtaccatgctgagtccatcgccaacgtccgggaggcggtggagagc
tttgcaggttccccactcagctaccggcccgtggccatcgccctggacaccaagggaccg
gagatccgcactgggatcctgcaggggggtccagagtcggaagtggagctggtgaagggc
tcccaggtgctggtgactgtggaccccgcgttccggacgcgggggaacgcgaacaccgtg
tgggtggactaccccaatattgtccgggtcgtgccggtggggggccgcatctacattgac
gacgggctcatctccctagtggtccagaaaatcggcccagagggactggtgacccaagtg
gagaacggcggcgtcctgggcagccggaagggcgtgaacttgccaggggcccaggtggac
ttgcccgggctgtccgagcaggacgtccgagacctgcgcttcggggtggagcatggggtg
gacatcgtctttgcctcctttgtgcggaaagccagcgacgtggctgccgtcagggctgct
ctgggtccggaaggacacggcatcaagatcatcagcaaaattgagaaccacgaaggcgtg
aagaggtttgatgaaatcctggaggtgagcgacggcatcatggtggcacggggggaccta
ggcatcgagatcccagcagagaaggttttcctggctcagaagatgatgattgggcgctgc
aacttggcgggcaagcctgttgtctgtgccacacagatgctggagagcatgattaccaag
ccccggccaacgagggcagagacaagcgatgtcgccaatgctgtgctggatggggctgac
tgcatcatgctgtcaggggagactgccaagggcaacttccctgtggaagcggtgaagatg
cagcatgcgattgcccgggaggcagaggccgcagtgtaccaccggcagctgtttgaggag
ctacgtcgggcagcgccactaagccgtgatcccactgaggtcaccgccattggtgctgtg
gaggctgccttcaagtgctgtgctgctgccatcattgtgctgaccacaactggccgctca
gcccagcttctgtctcggtaccgacctcgggcagcagtcattgctgtcacccgctctgcc
caggctgcccgccaggtccacttatgccgaggagtcttccccttgctttaccgtgaacct
ccagaagccatctgggcagatgatgtagatcgccgggtgcaatttggcattgaaagtgga
aagctccgtggcttcctccgtgttggagacctggtgattgtggtgacaggctggcgacct
ggctccggctacaccaacatcatgcgggtgctaagcatatcctga

DBGET integrated database retrieval system