KEGG   Homo sapiens (human): 5313Help
Entry
5313              CDS       T01001                                 

Gene name
PKLR, PK1, PKL, PKR, PKRL, RPK
Definition
pyruvate kinase, liver and RBC (EC:2.7.1.40)
Orthology
K12406  
pyruvate kinase isozymes R/L [EC:2.7.1.40]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Insulin signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Maturity onset diabetes of the young
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Disease
H01096  
Pyruvate kinase (PK) deficiency
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
Human Diseases; Endocrine and metabolic diseases; Maturity onset diabetes of the young [PATH:hsa04950]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1q21
AA seq 574 aa AA seqDB search
MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQ
LPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFS
HGSHEYHAESIANVREAVESFAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKG
SQVLVTVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQV
ENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGVDIVFASFVRKASDVAAVRAA
LGPEGHGIKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRC
NLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGETAKGNFPVEAVKM
QHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRS
AQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESG
KLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccaggagaacatatcatccctgcagcttcggtcatgggtctctaagtcccaa
agagacttagcaaagtccatcctgattggggctccaggagggccagcggggtatctgcgg
cgggccagtgtggcccaactgacccaggagctgggcactgccttcttccagcagcagcag
ctgccagctgctatggcagacaccttcctggaacacctctgcctactggacattgactcc
gagcccgtggctgctcgcagtaccagcatcattgccaccatcgggccagcatctcgctcc
gtggagcgcctcaaggagatgatcaaggccgggatgaacattgcgcgactcaacttctcc
cacggctcccacgagtaccatgctgagtccatcgccaacgtccgggaggcggtggagagc
tttgcaggttccccactcagctaccggcccgtggccatcgccctggacaccaagggaccg
gagatccgcactgggatcctgcaggggggtccagagtcggaagtggagctggtgaagggc
tcccaggtgctggtgactgtggaccccgcgttccggacgcgggggaacgcgaacaccgtg
tgggtggactaccccaatattgtccgggtcgtgccggtggggggccgcatctacattgac
gacgggctcatctccctagtggtccagaaaatcggcccagagggactggtgacccaagtg
gagaacggcggcgtcctgggcagccggaagggcgtgaacttgccaggggcccaggtggac
ttgcccgggctgtccgagcaggacgtccgagacctgcgcttcggggtggagcatggggtg
gacatcgtctttgcctcctttgtgcggaaagccagcgacgtggctgccgtcagggctgct
ctgggtccggaaggacacggcatcaagatcatcagcaaaattgagaaccacgaaggcgtg
aagaggtttgatgaaatcctggaggtgagcgacggcatcatggtggcacggggggaccta
ggcatcgagatcccagcagagaaggttttcctggctcagaagatgatgattgggcgctgc
aacttggcgggcaagcctgttgtctgtgccacacagatgctggagagcatgattaccaag
ccccggccaacgagggcagagacaagcgatgtcgccaatgctgtgctggatggggctgac
tgcatcatgctgtcaggggagactgccaagggcaacttccctgtggaagcggtgaagatg
cagcatgcgattgcccgggaggcagaggccgcagtgtaccaccggcagctgtttgaggag
ctacgtcgggcagcgccactaagccgtgatcccactgaggtcaccgccattggtgctgtg
gaggctgccttcaagtgctgtgctgctgccatcattgtgctgaccacaactggccgctca
gcccagcttctgtctcggtaccgacctcgggcagcagtcattgctgtcacccgctctgcc
caggctgcccgccaggtccacttatgccgaggagtcttccccttgctttaccgtgaacct
ccagaagccatctgggcagatgatgtagatcgccgggtgcaatttggcattgaaagtgga
aagctccgtggcttcctccgtgttggagacctggtgattgtggtgacaggctggcgacct
ggctccggctacaccaacatcatgcgggtgctaagcatatcctga

DBGET integrated database retrieval system