KEGG   Homo sapiens (human): 5340Help
Entry
5340              CDS       T01001                                 

Gene name
PLG
Definition
plasminogen (EC:3.4.21.7)
Orthology
K01315  
plasminogen [EC:3.4.21.7]
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Complement and coagulation cascades
Staphylococcus aureus infection
Influenza A
Disease
H00223  
Inherited thrombophilia
H01206  
Plasminogen deficiency
Drug target
Aminocaproic acid: 
Tranexamic acid: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
6q26
AA seq 810 aa AA seqDB search
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE
CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE
LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTE
QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atggaacataaggaagtggttcttctacttcttttatttctgaaatcaggtcaaggagag
cctctggatgactatgtgaatacccagggggcttcactgttcagtgtcactaagaagcag
ctgggagcaggaagtatagaagaatgtgcagcaaaatgtgaggaggacgaagaattcacc
tgcagggcattccaatatcacagtaaagagcaacaatgtgtgataatggctgaaaacagg
aagtcctccataatcattaggatgagagatgtagttttatttgaaaagaaagtgtatctc
tcagagtgcaagactgggaatggaaagaactacagagggacgatgtccaaaacaaaaaat
ggcatcacctgtcaaaaatggagttccacttctccccacagacctagattctcacctgct
acacacccctcagagggactggaggagaactactgcaggaatccagacaacgatccgcag
gggccctggtgctatactactgatccagaaaagagatatgactactgcgacattcttgag
tgtgaagaggaatgtatgcattgcagtggagaaaactatgacggcaaaatttccaagacc
atgtctggactggaatgccaggcctgggactctcagagcccacacgctcatggatacatt
ccttccaaatttccaaacaagaacctgaagaagaattactgtcgtaaccccgatagggag
ctgcggccttggtgtttcaccaccgaccccaacaagcgctgggaactttgtgacatcccc
cgctgcacaacacctccaccatcttctggtcccacctaccagtgtctgaagggaacaggt
gaaaactatcgcgggaatgtggctgttaccgtgtccgggcacacctgtcagcactggagt
gcacagacccctcacacacataacaggacaccagaaaacttcccctgcaaaaatttggat
gaaaactactgccgcaatcctgacggaaaaagggccccatggtgccatacaaccaacagc
caagtgcggtgggagtactgtaagataccgtcctgtgactcctccccagtatccacggaa
caattggctcccacagcaccacctgagctaacccctgtggtccaggactgctaccatggt
gatggacagagctaccgaggcacatcctccaccaccaccacaggaaagaagtgtcagtct
tggtcatctatgacaccacaccggcaccagaagaccccagaaaactacccaaatgctggc
ctgacaatgaactactgcaggaatccagatgccgataaaggcccctggtgttttaccaca
gaccccagcgtcaggtgggagtactgcaacctgaaaaaatgctcaggaacagaagcgagt
gttgtagcacctccgcctgttgtcctgcttccagatgtagagactccttccgaagaagac
tgtatgtttgggaatgggaaaggataccgaggcaagagggcgaccactgttactgggacg
ccatgccaggactgggctgcccaggagccccatagacacagcattttcactccagagaca
aatccacgggcgggtctggaaaaaaattactgccgtaaccctgatggtgatgtaggtggt
ccctggtgctacacgacaaatccaagaaaactttacgactactgtgatgtccctcagtgt
gcggccccttcatttgattgtgggaagcctcaagtggagccgaagaaatgtcctggaagg
gttgtaggggggtgtgtggcccacccacattcctggccctggcaagtcagtcttagaaca
aggtttggaatgcacttctgtggaggcaccttgatatccccagagtgggtgttgactgct
gcccactgcttggagaagtccccaaggccttcatcctacaaggtcatcctgggtgcacac
caagaagtgaatctcgaaccgcatgttcaggaaatagaagtgtctaggctgttcttggag
cccacacgaaaagatattgccttgctaaagctaagcagtcctgccgtcatcactgacaaa
gtaatcccagcttgtctgccatccccaaattatgtggtcgctgaccggaccgaatgtttc
atcactggctggggagaaacccaaggtacttttggagctggccttctcaaggaagcccag
ctccctgtgattgagaataaagtgtgcaatcgctatgagtttctgaatggaagagtccaa
tccaccgaactctgtgctgggcatttggccggaggcactgacagttgccagggtgacagt
ggaggtcctctggtttgcttcgagaaggacaaatacattttacaaggagtcacttcttgg
ggtcttggctgtgcacgccccaataagcctggtgtctatgttcgtgtttcaaggtttgtt
acttggattgagggagtgatgagaaataattaa

DBGET integrated database retrieval system