KEGG   Homo sapiens (human): 5340Help
Entry
5340              CDS       T01001                                 

Gene name
PLG
Definition
plasminogen (EC:3.4.21.7)
Orthology
K01315  
plasminogen [EC:3.4.21.7]
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Complement and coagulation cascades
Staphylococcus aureus infection
Influenza A
Disease
H00223  
Inherited thrombophilia
H01206  
Plasminogen deficiency
Drug target
Aminocaproic acid: 
Tranexamic acid: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5340 (PLG)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    5340 (PLG)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    5340 (PLG)
   05164 Influenza A
    5340 (PLG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.7  plasmin
     5340 (PLG)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   5340 (PLG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5340 (PLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
6q26
AA seq 810 aa AA seqDB search
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE
CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE
LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTE
QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atggaacataaggaagtggttcttctacttcttttatttctgaaatcaggtcaaggagag
cctctggatgactatgtgaatacccagggggcttcactgttcagtgtcactaagaagcag
ctgggagcaggaagtatagaagaatgtgcagcaaaatgtgaggaggacgaagaattcacc
tgcagggcattccaatatcacagtaaagagcaacaatgtgtgataatggctgaaaacagg
aagtcctccataatcattaggatgagagatgtagttttatttgaaaagaaagtgtatctc
tcagagtgcaagactgggaatggaaagaactacagagggacgatgtccaaaacaaaaaat
ggcatcacctgtcaaaaatggagttccacttctccccacagacctagattctcacctgct
acacacccctcagagggactggaggagaactactgcaggaatccagacaacgatccgcag
gggccctggtgctatactactgatccagaaaagagatatgactactgcgacattcttgag
tgtgaagaggaatgtatgcattgcagtggagaaaactatgacggcaaaatttccaagacc
atgtctggactggaatgccaggcctgggactctcagagcccacacgctcatggatacatt
ccttccaaatttccaaacaagaacctgaagaagaattactgtcgtaaccccgatagggag
ctgcggccttggtgtttcaccaccgaccccaacaagcgctgggaactttgtgacatcccc
cgctgcacaacacctccaccatcttctggtcccacctaccagtgtctgaagggaacaggt
gaaaactatcgcgggaatgtggctgttaccgtgtccgggcacacctgtcagcactggagt
gcacagacccctcacacacataacaggacaccagaaaacttcccctgcaaaaatttggat
gaaaactactgccgcaatcctgacggaaaaagggccccatggtgccatacaaccaacagc
caagtgcggtgggagtactgtaagataccgtcctgtgactcctccccagtatccacggaa
caattggctcccacagcaccacctgagctaacccctgtggtccaggactgctaccatggt
gatggacagagctaccgaggcacatcctccaccaccaccacaggaaagaagtgtcagtct
tggtcatctatgacaccacaccggcaccagaagaccccagaaaactacccaaatgctggc
ctgacaatgaactactgcaggaatccagatgccgataaaggcccctggtgttttaccaca
gaccccagcgtcaggtgggagtactgcaacctgaaaaaatgctcaggaacagaagcgagt
gttgtagcacctccgcctgttgtcctgcttccagatgtagagactccttccgaagaagac
tgtatgtttgggaatgggaaaggataccgaggcaagagggcgaccactgttactgggacg
ccatgccaggactgggctgcccaggagccccatagacacagcattttcactccagagaca
aatccacgggcgggtctggaaaaaaattactgccgtaaccctgatggtgatgtaggtggt
ccctggtgctacacgacaaatccaagaaaactttacgactactgtgatgtccctcagtgt
gcggccccttcatttgattgtgggaagcctcaagtggagccgaagaaatgtcctggaagg
gttgtaggggggtgtgtggcccacccacattcctggccctggcaagtcagtcttagaaca
aggtttggaatgcacttctgtggaggcaccttgatatccccagagtgggtgttgactgct
gcccactgcttggagaagtccccaaggccttcatcctacaaggtcatcctgggtgcacac
caagaagtgaatctcgaaccgcatgttcaggaaatagaagtgtctaggctgttcttggag
cccacacgaaaagatattgccttgctaaagctaagcagtcctgccgtcatcactgacaaa
gtaatcccagcttgtctgccatccccaaattatgtggtcgctgaccggaccgaatgtttc
atcactggctggggagaaacccaaggtacttttggagctggccttctcaaggaagcccag
ctccctgtgattgagaataaagtgtgcaatcgctatgagtttctgaatggaagagtccaa
tccaccgaactctgtgctgggcatttggccggaggcactgacagttgccagggtgacagt
ggaggtcctctggtttgcttcgagaaggacaaatacattttacaaggagtcacttcttgg
ggtcttggctgtgcacgccccaataagcctggtgtctatgttcgtgtttcaaggtttgtt
acttggattgagggagtgatgagaaataattaa

DBGET integrated database retrieval system