KEGG   Homo sapiens (human): 5350Help
Entry
5350              CDS       T01001                                 

Gene name
PLN, CMD1P, CMH18, PLB
Definition
phospholamban
Orthology
K05852  
phospholamban
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Adrenergic signaling in cardiomyocytes
Thyroid hormone signaling pathway
Dilated cardiomyopathy
Disease
H00294  
Dilated cardiomyopathy (DCM)
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
6q22.1
AA seq 52 aa AA seqDB search
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
NT seq 159 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagtccaatacctcactcgctcagctataagaagagcctcaaccattgaaatg
cctcaacaagcacgtcaaaagctacagaatctatttatcaatttctgtctcatcttaata
tgtctcttgctgatctgtatcatcgtgatgcttctctga

DBGET integrated database retrieval system