KEGG   Homo sapiens (human): 53832Help
Entry
53832             CDS       T01001                                 

Gene name
IL20RA, CRF2-8, IL-20R-alpha, IL-20R1, IL-20RA
Definition
interleukin 20 receptor, alpha
Orthology
K05136  
interleukin 20 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    53832 (IL20RA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    53832 (IL20RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
6q23.3
AA seq 504 aa AA seqDB search
MKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYY
AKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLP
VSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRA
QPSEKQCARTLKDQSSEFKAKIIFWYVLPISITVFLFSVMGYSIYRYIHVGKEKHPANLI
LIYGNEFDKRFFVPAEKIVINFITLNISDDSKISHQDMSLLGKSSDVSSLNDPQPSGNLR
PPQEEEEVKHLGYASHLMEIFCDSEENTEGTSLTQQESLSRTIPPDKTVIEYEYDVRTTD
ICAGPEEQELSLQEEVSTQGTLLESQAALAVLGPQTLQYSYTPQLQDLDPLAQEHTDSEE
GPEEEPSTTLVDWDPQTGRLCIPSLSSFDQDSEGCEPSEGDGLGEEGLLSRLYEEPAPDR
PPGENETYLMQFMEEWGLYVQMEN
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgtcctacaatggactccaccagagggtcttcaaggagttaaagttacttac
actgtgcagtatttcatatatgggcaaaagaaatggctgaataaatcagaatgcagaaat
atcaatagaacctactgtgatctttctgctgaaacttctgactacgaacaccagtattat
gccaaagttaaggccatttggggaacaaagtgttccaaatgggctgaaagtggacggttc
tatccttttttagaaacacaaattggcccaccagaggtggcactgactacagatgagaag
tccatttctgttgtcctgacagctccagagaagtggaagagaaatccagaagaccttcct
gtttccatgcaacaaatatactccaatctgaagtataacgtgtctgtgttgaatactaaa
tcaaacagaacgtggtcccagtgtgtgaccaaccacacgctggtgctcacctggctggag
ccgaacactctttactgcgtacacgtggagtccttcgtcccagggccccctcgccgtgct
cagccttctgagaagcagtgtgccaggactttgaaagatcaatcatcagagttcaaggct
aaaatcatcttctggtatgttttgcccatatctattaccgtgtttcttttttctgtgatg
ggctattccatctaccgatatatccacgttggcaaagagaaacacccagcaaatttgatt
ttgatttatggaaatgaatttgacaaaagattctttgtgcctgctgaaaaaatcgtgatt
aactttatcaccctcaatatctcggatgattctaaaatttctcatcaggatatgagttta
ctgggaaaaagcagtgatgtatccagccttaatgatcctcagcccagcgggaacctgagg
ccccctcaggaggaagaggaggtgaaacatttagggtatgcttcgcatttgatggaaatt
ttttgtgactctgaagaaaacacggaaggtacttctctcacccagcaagagtccctcagc
agaacaatacccccggataaaacagtcattgaatatgaatatgatgtcagaaccactgac
atttgtgcggggcctgaagagcaggagctcagtttgcaggaggaggtgtccacacaagga
acattattggagtcgcaggcagcgttggcagtcttgggcccgcaaacgttacagtactca
tacacccctcagctccaagacttagaccccctggcgcaggagcacacagactcggaggag
gggccggaggaagagccatcgacgaccctggtcgactgggatccccaaactggcaggctg
tgtattccttcgctgtccagcttcgaccaggattcagagggctgcgagccttctgagggg
gatgggctcggagaggagggtcttctatctagactctatgaggagccggctccagacagg
ccaccaggagaaaatgaaacctatctcatgcaattcatggaggaatgggggttatatgtg
cagatggaaaactga

DBGET integrated database retrieval system