KEGG   Homo sapiens (human): 5426Help
Entry
5426              CDS       T01001                                 

Gene name
POLE, CRCS12, FILS, POLE1
Definition
polymerase (DNA directed), epsilon, catalytic subunit (EC:2.7.7.7)
Orthology
K02324  
DNA polymerase epsilon subunit 1 [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
HTLV-I infection
Module
DNA polymerase epsilon complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:hsa03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:hsa03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:hsa03420]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
12q24.3
AA seq 2286 aa AA seqDB search
MSLRSGGRRRADPGADGEASRDDGATSSVSALKRLERSQWTDKMDLRFGFERLKEPGEKT
GWLINMHPTEILDEDKRLGSAVDYYFIQDDGSRFKVALPYKPYFYIATRKGCEREVSSFL
SKKFQGKIAKVETVPKEDLDLPNHLVGLKRNYIRLSFHTVEDLVKVRKEISPAVKKNREQ
DHASDAYTALLSSVLQRGGVITDEEETSKKIADQLDNIVDMREYDVPYHIRLSIDLKIHV
AHWYNVRYRGNAFPVEITRRDDLVERPDPVVLAFDIETTKLPLKFPDAETDQIMMISYMI
DGQGYLITNREIVSEDIEDFEFTPKPEYEGPFCVFNEPDEAHLIQRWFEHVQETKPTIMV
TYNGDFFDWPFVEARAAVHGLSMQQEIGFQKDSQGEYKAPQCIHMDCLRWVKRDSYLPVG
SHNLKAAAKAKLGYDPVELDPEDMCRMATEQPQTLATYSVSDAVATYYLYMKYVHPFIFA
LCTIIPMEPDEVLRKGSGTLCEALLMVQAFHANIIFPNKQEQEFNKLTDDGHVLDSETYV
GGHVEALESGVFRSDIPCRFRMNPAAFDFLLQRVEKTLRHALEEEEKVPVEQVTNFEEVC
DEIKSKLASLKDVPSRIECPLIYHLDVGAMYPNIILTNRLQPSAMVDEATCAACDFNKPG
ANCQRKMAWQWRGEFMPASRSEYHRIQHQLESEKFPPLFPEGPARAFHELSREEQAKYEK
RRLADYCRKAYKKIHITKVEERLTTICQRENSFYVDTVRAFRDRRYEFKGLHKVWKKKLS
AAVEVGDAAEVKRCKNMEVLYDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGIVCFTGA
NIITQARELIEQIGRPLELDTDGIWCVLPNSFPENFVFKTTNVKKPKVTISYPGAMLNIM
VKEGFTNDQYQELAEPSSLTYVTRSENSIFFEVDGPYLAMILPASKEEGKKLKKRYAVFN
EDGSLAELKGFEVKRRGELQLIKIFQSSVFEAFLKGSTLEEVYGSVAKVADYWLDVLYSK
AANMPDSELFELISENRSMSRKLEDYGEQKSTSISTAKRLAEFLGDQMVKDAGLSCRYII
SRKPEGSPVTERAIPLAIFQAEPTVRKHFLRKWLKSSSLQDFDIRAILDWDYYIERLGSA
IQKIITIPAALQQVKNPVPRVKHPDWLHKKLLEKNDVYKQKKISELFTLEGRRQVTMAEA
SEDSPRPSAPDMEDFGLVKLPHPAAPVTVKRKRVLWESQEESQDLTPTVPWQEILGQPPA
LGTSQEEWLVWLRFHKKKWQLQARQRLARRKRQRLESAEGVLRPGAIRDGPATGLGSFLR
RTARSILDLPWQIVQISETSQAGLFRLWALVGSDLHCIRLSIPRVFYVNQRVAKAEEGAS
YRKVNRVLPRSNMVYNLYEYSVPEDMYQEHINEINAELSAPDIEGVYETQVPLLFRALVH
LGCVCVVNKQLVRHLSGWEAETFALEHLEMRSLAQFSYLEPGSIRHIYLYHHAQAHKALF
GIFIPSQRRASVFVLDTVRSNQMPSLGALYSAEHGLLLEKVGPELLPPPKHTFEVRAETD
LKTICRAIQRFLLAYKEERRGPTLIAVQSSWELKRLASEIPVLEEFPLVPICVADKINYG
VLDWQRHGARRMIRHYLNLDTCLSQAFEMSRYFHIPIGNLPEDISTFGSDLFFARHLQRH
NHLLWLSPTARPDLGGKEADDNCLVMEFDDQATVEINSSGCYSTVCVELDLQNLAVNTIL
QSHHVNDMEGADSMGISFDVIQQASLEDMITGGQAASAPASYDETALCSNTFRILKSMVV
GWVKEITQYHNIYADNQVMHFYRWLRSPSSLLHDPALHRTLHNMMKKLFLQLIAEFKRLG
SSVIYANFNRIILCTKKRRVEDAIAYVEYITSSIHSKETFHSLTISFSRCWEFLLWMDPS
NYGGIKGKVSSRIHCGLQDSQKAGGAEDEQENEDDEEERDGEEEEEAEESNVEDLLENNW
NILQFLPQAASCQNYFLMIVSAYIVAVYHCMKDGLRRSAPGSTPVRRRGASQLSQEAEGA
VGALPGMITFSQDYVANELTQSFFTITQKIQKKVTGSRNSTELSEMFPVLPGSHLLLNNP
ALEFIKYVCKVLSLDTNITNQVNKLNRDLLRLVDVGEFSEEAQFRDPCRSYVLPEVICRS
CNFCRDLDLCKDSSFSEDGAVLPQWLCSNCQAPYDSSAIEMTLVEVLQKKLMAFTLQDLV
CLKCRGVKETSMPVYCSCAGDFALTIHTQVFMEQIGIFRNIAQHYGMSYLLETLEWLLQK
NPQLGH
NT seq 6861 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgaggagcggcgggcggcggcgcgcggacccaggcgcggatggcgaggccagc
agggatgatggcgccacttcctcagtttcggcactcaagcgcctggaacggagtcagtgg
acggataagatggatttgcggtttggttttgagcggctgaaggagcctggtgagaagaca
ggctggctcattaacatgcatcctaccgagattttagatgaagataagcgcttaggcagt
gcagtggattactactttattcaagatgacggaagcagatttaaggtggctttgccctat
aaaccgtatttctacattgcgaccagaaagggttgtgagcgagaagtttcatcttttctc
tccaagaagtttcagggcaaaattgcaaaagtggagactgtccccaaagaggatctggac
ttgccaaatcacttggtgggtttgaagcgaaattacatcaggctgtccttccacactgtg
gaggatcttgtcaaagtgaggaaggagatctcccctgccgtgaagaagaacagggagcag
gatcacgccagcgacgcgtacacagctctgctttccagtgttctgcagaggggcggtgtc
attactgatgaagaggaaacctctaagaagatagctgaccagttggacaacattgtggac
atgcgcgagtacgatgttccctaccacatccgcctctccattgacctgaagatccacgtg
gctcattggtacaatgtcagataccgaggaaatgcttttccggtagaaatcacccgccga
gatgaccttgttgaacgacctgaccctgtggttttggcatttgacattgagacgaccaaa
ctgcccctcaagtttcctgatgctgagacagaccagattatgatgatttcctacatgatc
gatggccagggctacctcatcaccaacagggagattgtttcagaagatattgaagatttt
gagttcacccccaagccagaatatgaaggccccttttgtgtcttcaatgaacccgatgag
gctcatctgatccaaaggtggtttgaacacgtccaggagaccaaacccaccatcatggtc
acctacaacggggacttttttgactggccatttgtggaggcccgggcagcagtccacggt
ctgagcatgcagcaggagataggcttccagaaggacagccagggggagtacaaggcgccc
cagtgcatccacatggactgcctcaggtgggtgaagagggacagttaccttcctgtgggc
agtcataatctcaaggcggccgccaaggccaagctaggctatgatcccgtggagctagac
ccggaggacatgtgccggatggccacggagcagccccagactctggccacgtattctgtg
tcagatgctgtcgccacttactacctgtacatgaagtacgtccacccattcatctttgct
ctgtgcaccattattcccatggagcccgacgaggtgctgcggaagggctctggcactctg
tgtgaggccttgctgatggtgcaggccttccacgccaacatcatcttccccaacaagcaa
gagcaggagttcaataagctgacggacgacggacacgtgctggactctgagacctacgtc
gggggccacgtggaggccctcgagtctggggttttccgcagcgatatcccttgccggttt
aggatgaatcctgccgcctttgacttcctgctgcagcgggttgagaagaccttgcgccac
gcccttgaggaagaggagaaagtgcctgtggagcaagtcaccaactttgaagaggtgtgt
gatgagattaagagcaagcttgcctccctgaaggacgttcccagccgcatcgagtgtcca
ctcatctaccacctggacgtgggggccatgtaccccaacatcatcctgaccaaccgcctg
cagccctctgccatggtggacgaagccacctgtgctgcctgtgacttcaataagcctgga
gcaaactgccagcggaagatggcctggcagtggaggggcgagttcatgccagccagtcgc
agcgaataccatcggatccagcaccagctggagtcagagaagttcccccccttgttccca
gaggggccagctcgggcctttcatgaactgtcccgcgaggaacaggcgaaatacgagaag
agaaggctggcggattactgccggaaagcctacaagaagatccacatcaccaaggtggaa
gagcgtctcaccaccatctgccagcgggaaaactccttctacgtggacaccgtgcgtgcc
ttccgggacaggcgttacgagttcaaagggctccacaaggtgtggaaaaagaagctctcg
gcggccgtggaggtgggcgacgcggctgaggtgaagcgctgcaagaacatggaggtgctg
tatgactcgctgcagctggcccacaagtgcatcctgaactccttctatggctatgtcatg
cgcaagggggctcgctggtactccatggagatggctggcatcgtctgcttcacaggggcc
aacatcatcacccaggcacgggagctgatcgagcagattgggaggcccttagagctggac
acagatggtatatggtgcgtcctgcccaacagcttcccagaaaattttgtcttcaagacg
accaatgtgaagaagcccaaagtgaccatctcctacccaggcgccatgttgaacatcatg
gtcaaggaaggcttcaccaatgaccagtaccaggagctggctgagccgtcctcactcacc
tacgtcacccgctcagagaacagcatcttttttgaggttgatgggccctaccttgccatg
attcttccagcctccaaggaagaaggcaagaaattgaagaagaggtatgctgtgttcaat
gaagacggttctctggctgagctcaagggctttgaggtcaaacgccgcggggaactgcag
ctgattaagatcttccaatcctcggtgtttgaggccttcctcaagggcagcacgctggaa
gaggtgtatggctctgtagccaaggtggctgactactggctggacgtgctgtacagcaag
gcagccaacatgcctgactctgagctattcgagctcatctctgagaaccgttccatgtct
cggaagctggaagattacggggagcagaagtctacgtccatcagcacagcaaagcgcctg
gccgagttcctgggagaccagatggtcaaggatgcagggctgagttgccgctacatcatc
tcccgcaagcccgagggctcccctgtcacggagagggccatcccacttgccattttccaa
gcagagcccacggtgaggaagcactttctccggaaatggctcaagagctcttcccttcaa
gactttgatattcgagcaattctggattgggactactacattgagcggctgggaagcgcc
atccagaagatcatcaccatccctgcggccctgcagcaggtaaagaacccagtgccacgt
gtcaaacaccccgactggctgcacaaaaaactgctggagaagaatgatgtctacaagcag
aagaagatcagtgagctcttcaccctggagggcaggagacaggtcacgatggccgaggcc
tcagaagacagtccgaggccaagtgctcctgacatggaggacttcggcctcgtaaagctg
cctcacccagcagcccctgtcactgtgaagaggaagcgagttctttgggagagccaggag
gagtcccaggacctcacgccgactgtgccctggcaggaaatcttggggcagcctcccgcc
ctgggaaccagccaggaggaatggcttgtctggctccggttccacaagaagaagtggcag
ctgcaggcccggcagcgcctcgcccgcaggaagaggcagcgtctggagtcggcagagggt
gtgctcaggcccggggccatccgggatggtcctgccacggggctggggagcttcttgcga
agaactgcccgcagcatcctggaccttccgtggcagattgtgcagatcagcgagaccagc
caggccggcctgttcaggctgtgggcgctcgttggcagtgacttgcactgcatcaggctg
agcatcccccgtgtgttctacgtgaaccagcgagtcgctaaagcggaggagggtgcttcg
tatcgcaaggtaaatcgggtccttcctcgctccaacatggtctacaatctctatgagtat
tcagtgccagaggacatgtaccaggaacacatcaacgagatcaacgctgagctgtcagcg
ccagacatcgagggcgtatatgagactcaggttccgttactgttccgggccctggtgcac
ctgggctgtgtgtgtgtggtcaataaacagctggtgaggcacctttcaggctgggaagca
gagacctttgctcttgagcacctggagatgcgctctctggcccagttcagctacctggaa
ccagggagtatccgccatatctacctgtaccaccacgcacaggcccacaaagcgctcttc
gggatcttcatcccctcacagcgcagggcatccgtctttgtgctggacactgtgcgcagc
aaccagatgcccagccttggcgccctgtactcagcagagcacggcctcctcctggagaag
gtgggccctgagctcctgccaccccccaaacacaccttcgaagttcgggcagaaactgac
ctgaagaccatctgcagagccatccagcgattcctgctcgcctacaaggaggagcgccgg
gggcccacactcatcgctgttcagtccagctgggagctgaagaggctggccagtgaaatt
cctgtcttggaggaattcccactggtgcctatctgtgtggctgacaagatcaactatggg
gtcctggactggcagcgccatggagcccggcgcatgatccgtcactacctcaacctggac
acctgcctgtcgcaggccttcgagatgagcaggtactttcacattcccattgggaaccta
ccagaggacatctccacattcggctccgacctcttctttgcccgccacctccagcgccac
aaccacctgctctggctgtcccctacagcccgccctgacctgggtggaaaggaggctgat
gacaactgtcttgtcatggagttcgatgaccaagccactgttgagatcaacagttcaggc
tgttactccacagtgtgtgtggagctggaccttcagaacctggccgtcaacaccattctc
cagtctcaccatgtcaacgacatggagggggccgacagcatggggatcagcttcgacgtg
atccagcaggcctccctggaggacatgatcacgggtggtcaggctgccagtgccccggcc
agctacgatgagacagccctgtgctctaacaccttcaggatcctgaagagcatggtcgtg
ggctgggtgaaggagatcacccagtaccacaacatctatgcagacaaccaggtgatgcac
ttctaccgctggcttcggtcgccatcctctctgcttcatgaccctgccctgcaccgcaca
ctccacaacatgatgaagaagctcttcctgcagctcatcgctgagttcaagcgcctgggg
tcatcagtcatctacgccaacttcaaccgcatcatcctctgtacaaagaagcgccgtgtg
gaagatgccatcgcttacgtggagtacatcaccagcagcatccattcaaaggagaccttc
cattctctgacaatttctttctctcgatgctgggaatttcttctctggatggatccatct
aactatggcggaatcaaaggaaaagtttcatctcgtattcactgtggactgcaagactcc
cagaaagcagggggagcagaggatgagcaggaaaatgaggacgatgaggaggaaagagat
ggggaggaggaggaagaggcggaggaatccaacgtggaggatttactggaaaacaactgg
aacattttgcagtttttgccacaggcagcctcctgccagaactacttcctcatgattgtt
tcagcgtacatcgtggccgtgtaccactgcatgaaggacgggctgaggcgcagtgctcca
gggagcacccccgtgaggaggaggggggccagccagctctcccaggaggccgagggggcg
gtcggagcccttcccggaatgatcaccttctctcaggattatgtcgcaaatgagctcact
cagagcttcttcaccatcactcagaagattcagaagaaagtcacaggctctcggaactcc
actgagctctcagagatgtttcctgtcctccccggttcccacttgctgctcaataaccct
gccctggagttcatcaaatacgtgtgcaaggtgctgtccctggacaccaacatcacaaac
caggtgaataagctgaaccgagacctgcttcgcctggtggatgtcggcgagttctccgag
gaggcccagttccgagacccctgccgctcctacgtgcttcctgaggtcatctgccgcagc
tgtaacttctgccgcgacctggacctgtgtaaagactcttccttctcagaggatggggcg
gtcctgcctcagtggctctgctccaactgtcaggcgccctacgactcctctgccatcgag
atgacgctggtggaagttctacagaagaagctgatggccttcaccctgcaggacctggtc
tgcctgaagtgccgcggggtgaaggagaccagcatgcctgtgtactgcagctgcgcggga
gacttcgccctcaccatccacacccaggtcttcatggaacagatcggaatattccggaac
attgcccagcactacggcatgtcgtacctcctggagaccctggagtggctgctgcagaag
aacccacagctgggccattag

DBGET integrated database retrieval system