KEGG   Homo sapiens (human): 54344Help
Entry
54344             CDS       T01001                                 

Gene name
DPM3, CDG1O
Definition
dolichyl-phosphate mannosyltransferase polypeptide 3 (EC:2.4.1.83)
Orthology
K09659  
dolichyl-phosphate mannosyltransferase polypeptide 3
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Disease
H00118  
Congenital disorders of glycosylation (CDG) type I
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hsa00510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
1q22
AA seq 122 aa AA seqDB search
MLSVGGLRLSLVRFSFLLLRGALLPSLAVTMTKLAQWLWGLAILGSTWVALTTGALGLEL
PLSCQEVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGL
RF
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgctctccgtgggcgggcttcggttgagtttggtccgcttttcctttctgctcctcagg
ggagcattgcttccttctctcgcagtgaccatgacgaaattagcgcagtggctttgggga
ctagcgatcctgggctccacctgggtggccctgaccacgggagccttgggcctggagctg
cccttgtcctgccaggaagtcctgtggccactgcccgcctacttgctggtgtccgccggc
tgctatgccctgggcactgtgggctatcgtgtggccacttttcatgactgcgaggacgcc
gcacgcgagctgcagagccagatacaggaggcccgagccgacttagcccgcagggggctg
cgcttctga

DBGET integrated database retrieval system