KEGG   Homo sapiens (human): 545Help
Entry
545               CDS       T01001                                 

Gene name
ATR, FCTCS, FRP1, MEC1, SCKL, SCKL1
Definition
ATR serine/threonine kinase (EC:2.7.11.1)
Orthology
K06640  
serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Fanconi anemia pathway
Cell cycle
p53 signaling pathway
HTLV-I infection
Disease
H00037  
Alveolar rhabdomyosarcoma
H00992  
Seckel syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    545 (ATR)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    545 (ATR)
   04115 p53 signaling pathway
    545 (ATR)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    545 (ATR)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     545 (ATR)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   545 (ATR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
3q23
AA seq 2644 aa AA seqDB search
MGEHGLELASMIPALRELGSATPEEYNTVVQKPRQILCQFIDRILTDVNVVAVELVKKTD
SQPTSVMLLDFIQHIMKSSPLMFVNVSGSHEAKGSCIEFSNWIITRLLRIAATPSCHLLH
KKICEVICSLLFLFKSKSPAIFGVLTKELLQLFEDLVYLHRRNVMGHAVEWPVVMSRFLS
QLDEHMGYLQSAPLQLMSMQNLEFIEVTLLMVLTRIIAIVFFRRQELLLWQIGCVLLEYG
SPKIKSLAISFLTELFQLGGLPAQPASTFFSSFLELLKHLVEMDTDQLKLYEEPLSKLIK
TLFPFEAEAYRNIEPVYLNMLLEKLCVMFEDGVLMRLKSDLLKAALCHLLQYFLKFVPAG
YESALQVRKVYVRNICKALLDVLGIEVDAEYLLGPLYAALKMESMEIIEEIQCQTQQENL
SSNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYS
GLKNPVIEMLEGIAVVLQLTALCTVHCSHQNMNCRTFKDCQHKSKKKPSVVITWMSLDFY
TKVLKSCRSLLESVQKLDLEATIDKVVKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIY
SHSDDGCLKLTTFAANLLTLSCRISDSYSPQAQSRCVFLLTLFPRRIFLEWRTAVYNWAL
QSSHEVIRASCVSGFFILLQQQNSCNRVPKILIDKVKDDSDIVKKEFASILGQLVCTLHG
MFYLTSSLTEPFSEHGHVDLFCRNLKATSQHECSSSQLKASVCKPFLFLLKKKIPSPVKL
AFIDNLHHLCKHLDFREDETDVKAVLGTLLNLMEDPDKDVRVAFSGNIKHILESLDSEDG
FIKELFVLRMKEAYTHAQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLLSKS
ASVSGAAYTEIRALVAAKSVKLQSFFSQYKKPICQFLVESLHSSQMTALPNTPCQNADVR
KQDVAHQREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGKQ
LNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHNELL
LRIGEHYQQVFNGLSILASFASSDDPYQGPRDIISPELMADYLQPKLLGILAFFNMQLLS
SSVGIEDKKMALNSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCFV
RCLDHACLGSLLSHVIVALLPLIHIQPKETAAIFHYLIIENRDAVQDFLHEIYFLPDHPE
LKKIKAVLQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLIK
YATDSETVEPIISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGKD
FTFVTGVEDSSFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGH
QLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGSNFAEWSASWAGYLIT
KVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIMAVLKHDD
QHTINTQDIASDLCQLSTQTVFSMLDHLTQWARHKFQALKAEKCPHSKSNRNKVDSMVST
VDYEDYQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQEHLGFLQKLY
AAMHEPDGVAGVSAIRKAEPSLKEQILEHESLGLLRDATACYDRAIQLEPDQIIHYHGVV
KSMLGLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKSTTW
SVRLGQLLLSAKKRDITAFYDSLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLHMLCEL
EHSIKPLFQHSPGDSSQEDSLNWVARLEMTQNSYRAKEPILALRRALLSLNKRPDYNEMV
GECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGV
ELCFPENETPPEGKNMLIHGRAMLLVGRFMEETANFESNAIMKKYKDVTACLPEWEDGHF
YLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLTLWLDYGTK
AYEWEKAGRSDRVQMRNDLGKINKVITEHTNYLAPYQFLTAFSQLISRICHSHDEVFVVL
MEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFVGDATRLTD
KLLELCNKPVDGSSSTLSMSTHFKMLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANH
ASHEPFPGHWAYIAGFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLME
FNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVY
MTGKELRQCMLPKSAALSEKLKVFREFLLPRHPPIFHEWFLRTFPDPTSWYSSRSAYCRS
TAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMV
NGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNET
GEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGW
TPYM
NT seq 7935 nt NT seq  +upstreamnt  +downstreamnt
atgggggaacatggcctggagctggcttccatgatccccgccctgcgggagctgggcagt
gccacaccagaggaatataatacagttgtacagaagccaagacaaattctgtgtcaattc
attgaccggatacttacagatgtaaatgttgttgctgtagaacttgtaaagaaaactgac
tctcagccaacctccgtgatgttgcttgatttcatccagcatatcatgaaatcctcccca
cttatgtttgtaaatgtgagtggaagccatgaggccaaaggcagttgtattgaattcagt
aattggatcataacgagacttctgcggattgcagcaactccctcctgtcatttgttacac
aagaaaatctgtgaagtcatctgttcattattatttctttttaaaagcaagagtcctgct
atttttggggtactcacaaaagaattattacaactttttgaagacttggtttacctccat
agaagaaatgtgatgggtcatgctgtggaatggccagtggtcatgagccgatttttaagt
caattagatgaacacatgggatatttacaatcagctcctttgcagttgatgagtatgcaa
aatttagaatttattgaagtcactttattaatggttcttactcgtattattgcaattgtg
ttttttagaaggcaagaactcttactttggcagataggttgtgttctgctagagtatggt
agtccaaaaattaaatccctagcaattagctttttaacagaactttttcagcttggagga
ctaccagcacaaccagctagcacttttttcagctcatttttggaattattaaaacacctt
gtagaaatggatactgaccaattgaaactctatgaagagccattatcaaagctgataaag
acactatttccctttgaagcagaagcttatagaaatattgaacctgtctatttaaatatg
ctgctggaaaaactctgtgtcatgtttgaagacggtgtgctcatgcggcttaagtctgat
ttgctaaaagcagctttgtgccatttactgcagtatttccttaaatttgtgccagctggg
tatgaatctgctttacaagtcaggaaggtctatgtgagaaatatttgtaaagctcttttg
gatgtgcttggaattgaggtagatgcagagtacttgttgggcccactttatgcagctttg
aaaatggaaagtatggaaatcattgaggagattcaatgccaaactcaacaggaaaacctc
agcagtaatagtgatggaatatcacccaaaaggcgtcgtctcagctcgtctctaaaccct
tctaaaagagcaccaaaacagactgaggaaattaaacatgtggacatgaaccaaaagagc
atattatggagtgcactgaaacagaaagctgaatcccttcagatttcccttgaatacagt
ggcctaaagaatcctgttattgagatgttagaaggaattgctgttgtcttacaactgact
gctctgtgtactgttcattgttctcatcaaaacatgaactgccgtactttcaaggactgt
caacataaatccaagaagaaaccttctgtagtgataacttggatgtcattggatttttac
acaaaagtgcttaagagctgtagaagtttgttagaatctgttcagaaactggacctggag
gcaaccattgataaggtggtgaaaatttatgatgctttgatttatatgcaagtaaacagt
tcatttgaagatcatatcctggaagatttatgtggtatgctctcacttccatggatttat
tcccattctgatgatggctgtttaaagttgaccacatttgccgctaatcttctaacatta
agctgtaggatttcagatagctattcaccacaggcacaatcacgatgtgtgtttcttctg
actctgtttccaagaagaatattccttgagtggagaacagcagtttacaactgggccctg
cagagctcccatgaagtaatccgggctagttgtgttagtggattttttatcttattgcag
cagcagaattcttgtaacagagttcccaagattcttatagataaagtcaaagatgattct
gacattgtcaagaaagaatttgcttctatacttggtcaacttgtctgtactcttcacggc
atgttttatctgacaagttctttaacagaacctttctctgaacacggacatgtggacctc
ttctgtaggaacttgaaagccacttctcaacatgaatgttcatcttctcaactaaaagct
tctgtctgcaagccattccttttcctactgaaaaaaaaaatacctagtccagtaaaactt
gctttcatagataatctacatcatctttgtaagcatcttgattttagagaagatgaaaca
gatgtaaaagcagttcttggaactttattaaatttaatggaagatccagacaaagatgtt
agagtggcttttagtggaaatatcaagcacatattggaatccttggactctgaagatgga
tttataaaggagctttttgtcttaagaatgaaggaagcatatacacatgcccaaatatca
agaaataatgagctgaaggataccttgattcttacaacaggggatattggaagggccgca
aaaggagatttggtaccatttgcactcttacacttattgcattgtttgttatccaagtca
gcatctgtctctggagcagcatacacagaaattagagctctggttgcagctaaaagtgtt
aaactgcaaagttttttcagccagtataagaaacccatctgtcagtttttggtagaatcc
cttcactctagtcagatgacagcacttccgaatactccatgccagaatgctgacgtgcga
aaacaagatgtggctcaccagagagaaatggctttaaatacgttgtctgaaattgccaac
gttttcgactttcctgatcttaatcgttttcttactaggacattacaagttctactacct
gatcttgctgccaaagcaagccctgcagcttctgctctcattcgaactttaggaaaacaa
ttaaatgtcaatcgtagagagattttaataaacaacttcaaatatattttttctcatttg
gtctgttcttgttccaaagatgaattagaacgtgcccttcattatctgaagaatgaaaca
gaaattgaactggggagcctgttgagacaagatttccaaggattgcataatgaattattg
ctgcgtattggagaacactatcaacaggtttttaatggtttgtcaatacttgcctcattt
gcatccagtgatgatccatatcagggcccgagagatatcatatcacctgaactgatggct
gattatttacaacccaaattgttgggcattttggctttttttaacatgcagttactgagc
tctagtgttggcattgaagataagaaaatggccttgaacagtttgatgtctttgatgaag
ttaatgggacccaaacatgtcagttctgtgagggtgaagatgatgaccacactgagaact
ggccttcgattcaaggatgattttcctgaattgtgttgcagagcttgggactgctttgtt
cgctgcctggatcatgcttgtctgggctcccttctcagtcatgtaatagtagctttgtta
cctcttatacacatccagcctaaagaaactgcagctatcttccactacctcataattgaa
aacagggatgctgtgcaagattttcttcatgaaatatattttttacctgatcatccagaa
ttaaaaaagataaaagccgttctccaggaatacagaaaggagacctctgagagcactgat
cttcagacaactcttcagctctctatgaaggccattcaacatgaaaatgtcgatgttcgt
attcatgctcttacaagcttgaaggaaaccttgtataaaaatcaggaaaaactgataaag
tatgcaacagacagtgaaacagtagaacctattatctcacagttggtgacagtgcttttg
aaaggttgccaagatgcaaactctcaagctcggttgctctgtggggaatgtttaggggaa
ttgggggcgatagatccaggtcgattagatttctcaacaactgaaactcaaggaaaagat
tttacatttgtgactggagtagaagattcaagctttgcctatggattattgatggagcta
acaagagcttaccttgcgtatgctgataatagccgagctcaagattcagctgcctatgcc
attcaggagttgctttctatttatgactgtagagagatggagaccaacggcccaggtcac
caattgtggaggagatttcctgagcatgttcgggaaatactagaacctcatctaaatacc
agatacaagagttctcagaagtcaaccgattggtctggagtaaagaagccaatttactta
agtaaattgggtagtaactttgcagaatggtcagcatcttgggcaggttatcttattaca
aaggttcgacatgatcttgccagtaaaattttcacctgctgtagcattatgatgaagcat
gatttcaaagtgaccatctatcttcttccacatattctggtgtatgtcttactgggttgt
aatcaagaagatcagcaggaggtttatgcagaaattatggcagttctaaagcatgacgat
cagcataccataaatacccaagacattgcatctgatctgtgtcaactcagtacacagact
gtgttctccatgcttgaccatctcacacagtgggcaaggcacaaatttcaggcactgaaa
gctgagaaatgtccacacagcaaatcaaacagaaataaggtagactcaatggtatctact
gtggattatgaagactatcagagtgtaacccgttttctagacctcataccccaggatact
ctggcagtagcttcctttcgctccaaagcatacacacgagctgtaatgcactttgaatca
tttattacagaaaagaagcaaaatattcaggaacatcttggatttttacagaaattgtat
gctgctatgcatgaacctgatggagtggccggagtcagtgcaattagaaaggcagaacca
tctctaaaagaacagatccttgaacatgaaagccttggcttgctgagggatgccactgct
tgttatgacagggctattcagctagaaccagaccagatcattcattatcatggtgtagta
aagtccatgttaggtcttggtcagctgtctactgttatcactcaggtgaatggagtgcat
gctaacaggtccgagtggacagatgaattaaacacgtacagagtggaagcagcttggaaa
ttgtcacagtgggatttggtggaaaactatttggcagcagatggaaaatctacaacatgg
agtgtcagactgggacagctattattatcagccaaaaaaagagatatcacagctttttat
gactcactgaaactagtgagagcagaacaaattgtacctctttcagctgcaagctttgaa
agaggctcctaccaacgaggatatgaatatattgtgagattgcacatgttatgtgagttg
gagcatagcatcaaaccacttttccagcattctccaggtgacagttctcaagaagattct
ctaaactgggtagctcgactagaaatgacccagaattcctacagagccaaggagcctatc
ctggctctccggagggctttactaagcctcaacaaaagaccagattacaatgaaatggtt
ggagaatgctggctgcagagtgccagggtagctagaaaggctggtcaccaccagacagcc
tacaatgctctccttaatgcaggggaatcacgactcgctgaactgtacgtggaaagggca
aagtggctctggtccaagggtgatgttcaccaggcactaattgttcttcaaaaaggtgtt
gaattatgttttcctgaaaatgaaaccccacctgagggtaagaacatgttaatccatggt
cgagctatgctactagtgggccgatttatggaagaaacagctaactttgaaagcaatgca
attatgaaaaaatataaggatgtgaccgcgtgcctgccagaatgggaggatgggcatttt
taccttgccaagtactatgacaaattgatgcccatggtcacagacaacaaaatggaaaag
caaggtgatctcatccggtatatagttcttcattttggcagatctctacaatatggaaat
cagttcatatatcagtcaatgccacgaatgttaactctatggcttgattatggtacaaag
gcatatgaatgggaaaaagctggccgctccgatcgtgtacaaatgaggaatgatttgggt
aaaataaacaaggttatcacagagcatacaaactatttagctccatatcaatttttgact
gctttttcacaattgatctctcgaatttgtcattctcacgatgaagtttttgttgtcttg
atggaaataatagccaaagtatttctagcctatcctcaacaagcaatgtggatgatgaca
gctgtgtcaaagtcatcttatcccatgcgtgtgaacagatgcaaggaaatcctcaataaa
gctattcatatgaaaaaatccttagagaagtttgttggagatgcaactcgcctaacagat
aagcttctagaattgtgcaataaaccggttgatggaagtagttccacattaagcatgagc
actcattttaaaatgcttaaaaagctggtagaagaagcaacatttagtgaaatcctcatt
cctctacaatcagtcatgatacctacacttccatcaattctgggtacccatgctaaccat
gctagccatgaaccatttcctggacattgggcctatattgcagggtttgatgatatggtg
gaaattcttgcttctcttcagaaaccaaagaagatttctttaaaaggctcagatggaaag
ttctacatcatgatgtgtaagccaaaagatgacctgagaaaggattgtagactaatggaa
ttcaattccttgattaataagtgcttaagaaaagatgcagagtctcgtagaagagaactt
catattcgaacatatgcagttattccactaaatgatgaatgtgggattattgaatgggtg
aacaacactgctggtttgagacctattctgaccaaactatataaagaaaagggagtgtat
atgacaggaaaagaacttcgccagtgtatgctaccaaagtcagcagctttatctgaaaaa
ctcaaagtattccgagaatttctcctgcccaggcatcctcctatttttcatgagtggttt
ctgagaacattccctgatcctacatcatggtacagtagtagatcagcttactgccgttcc
actgcagtaatgtcaatggttggttatattctggggcttggagaccgtcatggtgaaaat
attctctttgattctttgactggtgaatgcgtacatgtagatttcaattgtcttttcaat
aagggagaaacctttgaagttccagaaattgtgccatttcgcctgactcataatatggtt
aatggaatgggtcctatgggaacagagggtctttttcgaagagcatgtgaagttacaatg
aggctgatgcgtgatcagcgagagcctttaatgagtgtcttaaagacttttctacatgat
cctcttgtggaatggagtaaaccagtgaaagggcattccaaagcgccactgaatgaaact
ggagaagttgtcaatgaaaaggccaagacccatgttcttgacattgagcagcgactacaa
ggtgtaatcaagactcgaaatagagtgacaggactgccgttatctattgaaggacatgtg
cattaccttatacaggaagctactgatgaaaacttactatgccagatgtatcttggttgg
actccatatatgtga

DBGET integrated database retrieval system