KEGG   Homo sapiens (human): 54577Help
Entry
54577             CDS       T01001                                 

Gene name
UGT1A7, UDPGT, UDPGT_1-7, UGT-1G, UGT1-07, UGT1.7, UGT1G
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A7
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54577 (UGT1A7)
   00053 Ascorbate and aldarate metabolism
    54577 (UGT1A7)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    54577 (UGT1A7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54577 (UGT1A7)
   00860 Porphyrin and chlorophyll metabolism
    54577 (UGT1A7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54577 (UGT1A7)
   00982 Drug metabolism - cytochrome P450
    54577 (UGT1A7)
   00983 Drug metabolism - other enzymes
    54577 (UGT1A7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    54577 (UGT1A7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54577 (UGT1A7)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54577 (UGT1A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 54577
NCBI-ProteinID: NP_061950
OMIM: 606432
HGNC: 12539
Ensembl: ENSG00000244122
Vega: OTTHUMG00000059004
Pharos: Q9HAW7(Tbio)
UniProt: Q9HAW7 Q5DSZ7
LinkDB All DBs
Position
2q37.1
AA seq 530 aa AA seqDB search
MARAGWTGLLPLYVCLLLTCGFAKAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP
EVSWQLGRSLNCTVKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLF
FSNCRSLFNDRKLVEYLKESCFDAVFLDPFDACGLIVAKYFSLPSVVFARGIFCHYLEEG
AQCPAPLSYVPRLLLGFSDAMTFKERVWNHIMHLEEHLFCPYFFKNVLEIASEILQTPVT
AYDLYSHTSIWLLRTDFVLEYPKPVMPNMIFIGGINCHQGKPVPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgcagggtggactggcctccttcccctatatgtgtgtctactgctgacctgt
ggctttgccaaggcagggaagctgctggtagtgcccatggatgggagccactggttcacc
atgcagtcggtggtggagaaactcatcctcagggggcatgaggtggtcgtagtcatgcca
gaggtgagttggcaactgggaagatcactgaattgcacagtgaagacttactcaacctca
tacactctggaggatcaggaccgggagttcatggtttttgccgatgctcgctggacggca
ccattgcgaagtgcattttctctattaacaagttcatccaatggtatttttgacttattt
ttttcaaattgcaggagtttgtttaatgaccgaaaattagtagaatacttaaaggagagt
tgttttgatgcagtgtttctcgatccttttgatgcctgtggcttaattgttgccaaatat
ttctccctcccctctgtggtcttcgccaggggaatattttgccactatcttgaagaaggt
gcacagtgccctgctcctctttcctatgtccccagacttctcttagggttctcagacgcc
atgactttcaaggagagagtatggaaccacatcatgcacttggaggaacatttattttgc
ccctattttttcaaaaatgtcttagaaatagcctctgaaattctccaaacccctgtcacg
gcatatgatctctacagccacacatcaatttggttgttgcgaactgactttgttttggag
tatcccaaacccgtgatgcccaatatgatcttcattggtggtatcaactgtcatcaggga
aagccagtgcctatggaatttgaagcctacattaatgcttctggagaacatggaattgtg
gttttctctttgggatcaatggtctcagaaattccagagaagaaagctatggcaattgct
gatgctttgggcaaaatccctcagacagtcctgtggcggtacactggaacccgaccatcg
aatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgatctgcttggtcac
ccgatgacccgtgcctttatcacccatgctggttcccatggtgtttatgaaagcatatgc
aatggcgttcccatggtgatgatgcccttgtttggtgatcagatggacaatgcaaagcgc
atggagactaagggagctggagtgaccctgaatgttctggaaatgacttctgaagattta
gaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaacatcatgcgcctc
tccagccttcacaaggaccgcccggtggagccgctggacctggccgtgttctgggtggag
tttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccacgacctcacctgg
taccagtaccattccttggacgtgattggtttcctcttggccgtcgtgctgacagtggcc
ttcatcacctttaaatgttgtgcttatggctaccggaaatgcttggggaaaaaagggcga
gttaagaaagcccacaaatccaagacccattga

DBGET integrated database retrieval system