KEGG   Homo sapiens (human): 5471Help
Entry
5471              CDS       T01001                                 

Gene name
PPAT, ATASE, GPAT, PRAT
Definition
phosphoribosyl pyrophosphate amidotransferase (EC:2.4.2.14)
Orthology
K00764  
amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5471 (PPAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    5471 (PPAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     5471 (PPAT)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C44
   5471 (PPAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
4q12
AA seq 517 aa AA seqDB search
MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPT
FKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVA
HNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEA
PTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFL
SIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVY
TVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQP
NMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP
PIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKE
KKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaggagttggggatccgagaggaatgtggcgtgttcgggtgcatcgcctca
ggagagtggcccacgcagctggatgtaccgcatgtgatcactctgggactcgtggggctg
cagcaccggggtcaggagagtgctggtattgtgactagtgatgggagttcggtgccaaca
ttcaaatcacacaagggaatgggtcttgtaaatcacgtctttactgaagacaatttgaaa
aaattatatgtttcaaatcttggaattggacacaccaggtatgccaccacaggaaaatgt
gaactagaaaattgtcagcccttcgttgttgaaacacttcatgggaagatagctgtggca
cataatggcgaattggtaaatgctgctcgattaaggaaaaagcttctgcgtcatggtatt
ggtctgtctacaagttctgatagtgaaatgattacccagttactggcgtatacccctcct
caggaacaagatgacaccccagactgggtagccaggattaaaaacttgatgaaggaagca
cccacagcatactccctgcttataatgcacagagatgttatttatgcagtacgagatcct
tatggaaatcgtcccttatgcattggtcgtcttattccagtgtctgatataaatgacaaa
gagaaaaaaacatcagaaacagaaggatgggtggtgtcttcagaatcttgtagcttctta
tctattggtgcaagatattaccgtgaagtcttgcctggagaaattgtggaaatatccaga
cacaatgtccaaactcttgatattatatcaaggtctgaaggaaacccagtggctttttgt
atctttgaatatgtttattttgcaagaccagacagtatgttcgaagaccaaatggtttat
acagtaagataccgttgtggccagcagctagcgattgaagcacctgtggatgcagatttg
gttagcactgttccagaatctgctacgcctgctgctcttgcttacgcaggaaagtgtgga
cttccatatgtggaggtgctgtgtaaaaaccggtatgtagggagaaccttcattcagcca
aacatgaggttaagacaacttggtgttgcaaaaaaatttggagtattgtcagacaacttt
aaaggcaaaagaattgttcttgtagatgattcaattgtcagaggcaataccatctcacct
ataataaaactgctcaaagaatctggtgcaaaagaggtacacattcgagtagcttcacca
ccaattaaatatccatgcttcatgggaataaacattcctacaaaagaagagctcattgcc
aataaaccagaatttgatcaccttgcagaatatctaggagcaaacagtgttgtgtatctg
tcagtagaaggactggtttcatctgtacaagaagggataaagtttaaaaaacagaaagag
aaaaagcacgatattatgatccaagaaaatggaaatggtctggaatgttttgaaaagagt
ggtcattgtacagcttgtctcactggaaaatatcctgtagaattagaatggtag

DBGET integrated database retrieval system