KEGG   Homo sapiens (human): 5518Help
Entry
5518              CDS       T01001                                 

Gene name
PPP2R1A, PP2A-Aalpha, PP2AAALPHA, PR65A
Definition
protein phosphatase 2, regulatory subunit A, alpha (EC:3.1.3.16)
Orthology
K03456  
serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Oocyte meiosis
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
TGF-beta signaling pathway
Hippo signaling pathway
Tight junction
Dopaminergic synapse
Long-term depression
Chagas disease (American trypanosomiasis)
Hepatitis C
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:hsa03015]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
19q13.41
AA seq 589 aa AA seqDB search
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgacggcgacgactcgctgtaccccatcgcggtgctcatagacgaactc
cgcaatgaggacgttcagcttcgcctcaacagcatcaagaagctgtccaccatcgccttg
gcccttggggttgaaaggacccgaagtgagcttctgcctttccttacagataccatctat
gatgaagatgaggtcctcctggccctggcagaacagctgggaaccttcactaccctggtg
ggaggcccagagtacgtgcactgcctgctgccaccgctggagtcgctggccacagtggag
gagacagtggtgcgggacaaggcagtggagtccttacgggccatctcacacgagcactcg
ccctctgacctggaggcgcactttgtgccgctagtgaagcggctggcgggcggcgactgg
ttcacctcccgcacctcggcctgcggcctcttctccgtctgctacccccgagtgtccagt
gctgtgaaggcggaacttcgacagtacttccggaacctgtgctcagatgacacccccatg
gtgcggcgggccgcagcctccaagctgggggagtttgccaaggtgctggagctggacaac
gtcaagagtgagatcatccccatgttctccaacctggcctctgacgagcaggactcggtg
cggctgctggcggtggaggcgtgcgtgaacatcgcccagcttctgccccaggaggatctg
gaggccctggtgatgcccactctgcgccaggccgctgaagacaagtcctggcgcgtccgc
tacatggtggctgacaagttcacagagctccagaaagcagtggggcctgagatcaccaag
acagacctggtccctgccttccagaacctgatgaaagactgtgaggccgaggtgagggcc
gcagcctcccacaaggtcaaagagttctgtgaaaacctctcagctgactgtcgggagaat
gtgatcatgtcccagatcttgccctgcatcaaggagctggtgtccgatgccaaccaacat
gtcaagtctgccctggcctcagtcatcatgggtctctctcccatcttgggcaaagacaac
accatcgagcacctcttgcccctcttcctggctcagctgaaggatgagtgccctgaggta
cggctgaacatcatctctaacctggactgtgtgaacgaggtgattggcatccggcagctg
tcccagtccctgctccctgccattgtggagctggctgaggacgccaagtggcgggtgcgg
ctggccatcattgagtacatgcccctcctggctggacagctgggagtggagttctttgat
gagaaacttaactccttgtgcatggcctggcttgtggatcatgtatatgccatccgcgag
gcagccaccagcaacctgaagaagctagtggaaaagtttgggaaggagtgggcccatgcc
acaatcatccccaaggtcttggccatgtccggagaccccaactacctgcaccgcatgact
acgctcttctgcatcaatgtgctgtctgaggtctgtgggcaggacatcaccaccaagcac
atgctacccacggttctgcgcatggctggggacccggttgccaatgtccgcttcaatgtg
gccaagtctctgcagaagatagggcccatcctggacaacagcaccttgcagagtgaagtc
aagcccatcctagagaagctgacccaggaccaggatgtggacgtcaaatactttgcccag
gaggctctgactgttctgtctctcgcctga

DBGET integrated database retrieval system