KEGG   Homo sapiens (human): 5518Help
Entry
5518              CDS       T01001                                 

Gene name
PPP2R1A, MRD36, PP2A-Aalpha, PP2AAALPHA, PR65A
Definition
(RefSeq) protein phosphatase 2 scaffold subunit Aalpha
  KO
K03456  
serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Sphingolipid signaling pathway
Oocyte meiosis
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
TGF-beta signaling pathway
Hippo signaling pathway
Tight junction
Dopaminergic synapse
Long-term depression
Chagas disease (American trypanosomiasis)
Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    5518 (PPP2R1A)
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    5518 (PPP2R1A)
   04390 Hippo signaling pathway
    5518 (PPP2R1A)
   04071 Sphingolipid signaling pathway
    5518 (PPP2R1A)
   04151 PI3K-Akt signaling pathway
    5518 (PPP2R1A)
   04152 AMPK signaling pathway
    5518 (PPP2R1A)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    5518 (PPP2R1A)
  Cellular community - eukaryotes
   04530 Tight junction
    5518 (PPP2R1A)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5518 (PPP2R1A)
  Nervous system
   04728 Dopaminergic synapse
    5518 (PPP2R1A)
   04730 Long-term depression
    5518 (PPP2R1A)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    5518 (PPP2R1A)
   05142 Chagas disease (American trypanosomiasis)
    5518 (PPP2R1A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5518 (PPP2R1A)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5518 (PPP2R1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
19q13.41
AA seq 589 aa AA seqDB search
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgacggcgacgactcgctgtaccccatcgcggtgctcatagacgaactc
cgcaatgaggacgttcagcttcgcctcaacagcatcaagaagctgtccaccatcgccttg
gcccttggggttgaaaggacccgaagtgagcttctgcctttccttacagataccatctat
gatgaagatgaggtcctcctggccctggcagaacagctgggaaccttcactaccctggtg
ggaggcccagagtacgtgcactgcctgctgccaccgctggagtcgctggccacagtggag
gagacagtggtgcgggacaaggcagtggagtccttacgggccatctcacacgagcactcg
ccctctgacctggaggcgcactttgtgccgctagtgaagcggctggcgggcggcgactgg
ttcacctcccgcacctcggcctgcggcctcttctccgtctgctacccccgagtgtccagt
gctgtgaaggcggaacttcgacagtacttccggaacctgtgctcagatgacacccccatg
gtgcggcgggccgcagcctccaagctgggggagtttgccaaggtgctggagctggacaac
gtcaagagtgagatcatccccatgttctccaacctggcctctgacgagcaggactcggtg
cggctgctggcggtggaggcgtgcgtgaacatcgcccagcttctgccccaggaggatctg
gaggccctggtgatgcccactctgcgccaggccgctgaagacaagtcctggcgcgtccgc
tacatggtggctgacaagttcacagagctccagaaagcagtggggcctgagatcaccaag
acagacctggtccctgccttccagaacctgatgaaagactgtgaggccgaggtgagggcc
gcagcctcccacaaggtcaaagagttctgtgaaaacctctcagctgactgtcgggagaat
gtgatcatgtcccagatcttgccctgcatcaaggagctggtgtccgatgccaaccaacat
gtcaagtctgccctggcctcagtcatcatgggtctctctcccatcttgggcaaagacaac
accatcgagcacctcttgcccctcttcctggctcagctgaaggatgagtgccctgaggta
cggctgaacatcatctctaacctggactgtgtgaacgaggtgattggcatccggcagctg
tcccagtccctgctccctgccattgtggagctggctgaggacgccaagtggcgggtgcgg
ctggccatcattgagtacatgcccctcctggctggacagctgggagtggagttctttgat
gagaaacttaactccttgtgcatggcctggcttgtggatcatgtatatgccatccgcgag
gcagccaccagcaacctgaagaagctagtggaaaagtttgggaaggagtgggcccatgcc
acaatcatccccaaggtcttggccatgtccggagaccccaactacctgcaccgcatgact
acgctcttctgcatcaatgtgctgtctgaggtctgtgggcaggacatcaccaccaagcac
atgctacccacggttctgcgcatggctggggacccggttgccaatgtccgcttcaatgtg
gccaagtctctgcagaagatagggcccatcctggacaacagcaccttgcagagtgaagtc
aagcccatcctagagaagctgacccaggaccaggatgtggacgtcaaatactttgcccag
gaggctctgactgttctgtctctcgcctga

DBGET integrated database retrieval system