KEGG   Homo sapiens (human): 55204Help
Entry
55204             CDS       T01001                                 

Gene name
GOLPH3L, GPP34R
Definition
golgi phosphoprotein 3-like
Orthology
K15620  
golgi phosphoprotein 3
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    55204 (GOLPH3L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
1q21.3
AA seq 285 aa AA seqDB search
MTTLTHRARRTEISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDK
EGYTSFWNDCISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLD
ETLKHIKATEPTETVQTWIELLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNF
LLFDMTTHPVTNTTEKQRLVKKLQDSVLERWVNDPQRMDKRTLALLVLAHSSDVLENVFS
SLTDDKYDVAMNRAKDLVELDPEVEGTKPSATEMIWAVLAAFNKS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccactttaactcaccgggcccgtcgcactgaaataagcaagaactctgaaaagaag
atggaaagtgaggaagacagtaattgggagaaaagtccagacaatgaagattctggagac
tctaaggatatccgccttactcttatggaagaagtattgcttctgggactaaaagataaa
gaggggtacacatctttctggaatgactgcatatcatcaggcctgcgagggggcatcctg
atagagctggccatgcggggtcgaatctatctggaacccccgaccatgcgtaagaagcga
ctactagacagaaaggtactgctaaagtcagacagcccaacaggtgatgttttactggat
gaaactctgaaacacatcaaagcaactgaacccacagaaactgtccaaacatggatagag
ctactcactggtgagacctggaaccccttcaaattacagtaccagctgagaaatgtacga
gagcgcatcgcaaagaacctagtagagaaaggtattctaaccactgagaagcagaatttc
ctgctatttgacatgactactcatccagtgaccaatacaacagagaaacagcgactagtg
aaaaaacttcaagatagtgtactagagcggtgggtaaatgaccctcagcgtatggacaag
cgaacactagcactcctggtgctagcccactcctctgatgtgctagagaatgtcttctcc
tctctgacagatgacaagtatgatgtggcaatgaatcgagccaaggacttagtagaactg
gaccctgaagtggaagggacaaagcctagtgccacagaaatgatctgggctgtgctggca
gccttcaataaatcttaa

DBGET integrated database retrieval system