KEGG   Homo sapiens (human): 55224Help
Entry
55224             CDS       T01001                                 

Gene name
ETNK2, EKI2, HMFT1716
Definition
ethanolamine kinase 2 (EC:2.7.1.82)
Orthology
K00894  
ethanolamine kinase [EC:2.7.1.82]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    55224 (ETNK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.82  ethanolamine kinase
     55224 (ETNK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
1q32.1
AA seq 394 aa AA seqDB search
MAVPPSAPQPRASFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDP
DDILPGALRLIQELRPHWKPEQVRTKRFTDGITNKLVACYVEEDMQDCVLVRVYGERTEL
LVDRENEVRNFQLLRAHSCAPKLYCTFQNGLCYEYMQGVALEPEHIREPRLFRLIALEMA
KIHTIHANGSLPKPILWHKMHNYFTLVKNEINPSLSADVPKVEVLERELAWLKEHLSQLE
SPVVFCHNDLLCKNIIYDSIKGHVRFIDYEYAGYNYQAFDIGNHFNEFAGVNEVDYCLYP
ARETQLQWLHYYLQAQKGMAVTPREVQRLYVQVNKFALGPSCVSSTMTASLQCCRVGNRH
GEIARLTLSGLFPGVSLLLGSLGPHPEPVLHHRL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgcccccttcggcccctcagccgcgcgcgtcctttcacctgaggaggcacacg
ccttgcccgcagtgctcatggggcatggaggagaaggcggcggccagcgccagctgccgg
gagccgccgggccccccgagggccgccgccgtcgcgtacttcggcatttccgtggacccg
gacgacatccttcccggggccctgcgcctcatccaggagctgcggccgcattggaaaccc
gagcaagttcggaccaagcgcttcacggatggcatcaccaacaagctggtggcctgctat
gtggaggaggacatgcaggactgcgtgctggtccgggtgtatggggagcggacggagctg
ctggtggaccgggagaatgaggtcagaaacttccagctgctgcgagcacacagctgtgcc
cccaaactctactgcaccttccagaatgggctgtgctatgagtacatgcagggtgtggcc
ctggagcctgagcacatccgtgagccccggcttttcaggttaatcgccttagaaatggca
aagattcatactatccacgccaacggcagcctgcccaagcccatcctctggcacaagatg
cacaattatttcacgcttgtgaagaacgagatcaaccccagcctttctgcagatgtccct
aaggtagaggtgttggaacgggagctggcctggctgaaggagcatctgtcccagctggag
tcccctgtggtgttttgtcacaatgacctgctctgcaagaatatcatctatgacagcatc
aaaggtcacgtgcggttcattgactatgaatatgctggctacaactaccaagcttttgac
attggcaaccatttcaatgagtttgcaggcgtgaatgaggtggattactgcctgtacccg
gcgcgggagacccagctgcagtggctgcactactacctgcaggcacaaaaggggatggcc
gtgacccccagggaggtgcaaaggctctacgtgcaagtcaacaagtttgccctgggtcct
agctgtgtgtcttccacaatgactgcatccctccagtgctgtagagtcggaaacaggcat
ggggagattgccaggctgaccctctctggtctgtttccaggcgtctcacttcttctgggc
tctctgggccctcatccagaaccagtactccaccatcgactttga

DBGET integrated database retrieval system