KEGG   Homo sapiens (human): 55224Help
Entry
55224             CDS       T01001                                 

Gene name
ETNK2, EKI2, HMFT1716
Definition
(RefSeq) ethanolamine kinase 2
  KO
K00894  ethanolamine kinase [EC:2.7.1.82]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
Module
hsa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    55224 (ETNK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.82  ethanolamine kinase
     55224 (ETNK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase
Motif
Other DBs
NCBI-GeneID: 55224
NCBI-ProteinID: NP_060678
OMIM: 609859
HGNC: 25575
Ensembl: ENSG00000143845
Vega: OTTHUMG00000036061
Pharos: Q9NVF9(Tdark)
UniProt: Q9NVF9 A0A024R9A8
LinkDB All DBs
Position
1q32.1
AA seq 386 aa AA seqDB search
MAVPPSAPQPRASFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDP
DDILPGALRLIQELRPHWKPEQVRTKRFTDGITNKLVACYVEEDMQDCVLVRVYGERTEL
LVDRENEVRNFQLLRAHSCAPKLYCTFQNGLCYEYMQGVALEPEHIREPRLFRLIALEMA
KIHTIHANGSLPKPILWHKMHNYFTLVKNEINPSLSADVPKVEVLERELAWLKEHLSQLE
SPVVFCHNDLLCKNIIYDSIKGHVRFIDYEYAGYNYQAFDIGNHFNEFAGVNEVDYCLYP
ARETQLQWLHYYLQAQKGMAVTPREVQRLYVQVNKFALASHFFWALWALIQNQYSTIDFD
FLRYAVIRFNQYFKVKPQASALEMPK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgcccccttcggcccctcagccgcgcgcgtcctttcacctgaggaggcacacg
ccttgcccgcagtgctcatggggcatggaggagaaggcggcggccagcgccagctgccgg
gagccgccgggccccccgagggccgccgccgtcgcgtacttcggcatttccgtggacccg
gacgacatccttcccggggccctgcgcctcatccaggagctgcggccgcattggaaaccc
gagcaagttcggaccaagcgcttcacggatggcatcaccaacaagctggtggcctgctat
gtggaggaggacatgcaggactgcgtgctggtccgggtgtatggggagcggacggagctg
ctggtggaccgggagaatgaggtcagaaacttccagctgctgcgagcacacagctgtgcc
cccaaactctactgcaccttccagaatgggctgtgctatgagtacatgcagggtgtggcc
ctggagcctgagcacatccgtgagccccggcttttcaggttaatcgccttagaaatggca
aagattcatactatccacgccaacggcagcctgcccaagcccatcctctggcacaagatg
cacaattatttcacgcttgtgaagaacgagatcaaccccagcctttctgcagatgtccct
aaggtagaggtgttggaacgggagctggcctggctgaaggagcatctgtcccagctggag
tcccctgtggtgttttgtcacaatgacctgctctgcaagaatatcatctatgacagcatc
aaaggtcacgtgcggttcattgactatgaatatgctggctacaactaccaagcttttgac
attggcaaccatttcaatgagtttgcaggcgtgaatgaggtggattactgcctgtacccg
gcgcgggagacccagctgcagtggctgcactactacctgcaggcacaaaaggggatggcc
gtgacccccagggaggtgcaaaggctctacgtgcaagtcaacaagtttgccctggcgtct
cacttcttctgggctctctgggccctcatccagaaccagtactccaccatcgactttgat
ttcctcaggtacgcagtgatccgattcaaccagtacttcaaggtgaagcctcaagcgtca
gccttggagatgccaaagtga

DBGET integrated database retrieval system