KEGG   Homo sapiens (human): 55224Help
Entry
55224             CDS       T01001                                 

Gene name
ETNK2, EKI2, HMFT1716
Definition
ethanolamine kinase 2 (EC:2.7.1.82)
Orthology
K00894  
ethanolamine kinase [EC:2.7.1.82]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hsa00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
1q32.1
AA seq 386 aa AA seqDB search
MAVPPSAPQPRASFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDP
DDILPGALRLIQELRPHWKPEQVRTKRFTDGITNKLVACYVEEDMQDCVLVRVYGERTEL
LVDRENEVRNFQLLRAHSCAPKLYCTFQNGLCYEYMQGVALEPEHIREPRLFRLIALEMA
KIHTIHANGSLPKPILWHKMHNYFTLVKNEINPSLSADVPKVEVLERELAWLKEHLSQLE
SPVVFCHNDLLCKNIIYDSIKGHVRFIDYEYAGYNYQAFDIGNHFNEFAGVNEVDYCLYP
ARETQLQWLHYYLQAQKGMAVTPREVQRLYVQVNKFALASHFFWALWALIQNQYSTIDFD
FLRYAVIRFNQYFKVKPQASALEMPK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgcccccttcggcccctcagccgcgcgcgtcctttcacctgaggaggcacacg
ccttgcccgcagtgctcatggggcatggaggagaaggcggcggccagcgccagctgccgg
gagccgccgggccccccgagggccgccgccgtcgcgtacttcggcatttccgtggacccg
gacgacatccttcccggggccctgcgcctcatccaggagctgcggccgcattggaaaccc
gagcaagttcggaccaagcgcttcacggatggcatcaccaacaagctggtggcctgctat
gtggaggaggacatgcaggactgcgtgctggtccgggtgtatggggagcggacggagctg
ctggtggaccgggagaatgaggtcagaaacttccagctgctgcgagcacacagctgtgcc
cccaaactctactgcaccttccagaatgggctgtgctatgagtacatgcagggtgtggcc
ctggagcctgagcacatccgtgagccccggcttttcaggttaatcgccttagaaatggca
aagattcatactatccacgccaacggcagcctgcccaagcccatcctctggcacaagatg
cacaattatttcacgcttgtgaagaacgagatcaaccccagcctttctgcagatgtccct
aaggtagaggtgttggaacgggagctggcctggctgaaggagcatctgtcccagctggag
tcccctgtggtgttttgtcacaatgacctgctctgcaagaatatcatctatgacagcatc
aaaggtcacgtgcggttcattgactatgaatatgctggctacaactaccaagcttttgac
attggcaaccatttcaatgagtttgcaggcgtgaatgaggtggattactgcctgtacccg
gcgcgggagacccagctgcagtggctgcactactacctgcaggcacaaaaggggatggcc
gtgacccccagggaggtgcaaaggctctacgtgcaagtcaacaagtttgccctggcgtct
cacttcttctgggctctctgggccctcatccagaaccagtactccaccatcgactttgat
ttcctcaggtacgcagtgatccgattcaaccagtacttcaaggtgaagcctcaagcgtca
gccttggagatgccaaagtga

DBGET integrated database retrieval system