KEGG   Homo sapiens (human): 55500Help
Entry
55500             CDS       T01001                                 

Gene name
ETNK1, EKI, EKI_1, EKI1, Nbla10396
Definition
(RefSeq) ethanolamine kinase 1 (EC:2.7.1.82)
  KO
K00894  
ethanolamine kinase [EC:2.7.1.82]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    55500 (ETNK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.82  ethanolamine kinase
     55500 (ETNK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
12p12.1
AA seq 452 aa AA seqDB search
MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGT
EGSTSLSAPAVLVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCRE
GALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRD
EEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFRLIARQLAKIHAI
HAHNGWIPKSNLWLKMGKYFSLIPTGFADEDINKRFLSDIPSSQILQEEMTWMKEILSNL
GSPVVLCHNDLLCKNIIYNEKQGDVQFIDYEYSGYNYLAYDIGNHFNEFAGVSDVDYSLY
PDRELQSQWLRAYLEAYKEFKGFGTEVTEKEVEILFIQVNQFALASHFFWGLWALIQAKY
STIEFDFLGYAIVRFNQYFKMKPEVTALKVPE
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgctctgcggccgcccgcggtccagctccgacaacaggaattttctccgagagcgggcc
gggctcagttcagctgctgtccagacccggatcggcaacagtgccgcctccagacgttct
cctgccgctcgcccgcccgtcccagcgcccccagccctcccgcgagggcgccccgggacg
gaaggatccaccagtctgtcggcgcccgccgttctcgtggtcgccgtcgccgtcgtcgtg
gtggtagtctccgccgtcgcctgggccatggccaattacatccacgtccctcccggctcc
ccggaggtgcccaagctgaacgtcaccgttcaggatcaggaggagcatcgctgccgggag
ggggccctgagcctcctgcaacacctgcggcctcactgggacccccaggaggtgaccctg
cagctcttcacagatggaatcacaaataaacttattggctgttacgtgggaaacaccatg
gaggatgtagtcctggtgagaatttatggcaataagactgagttattagtcgatcgagat
gaggaagtaaagagttttcgagtgttgcaggctcatgggtgtgcaccacaactctactgt
accttcaataatggactatgctatgaatttatacaaggagaagcactggatccaaagcat
gtctgcaacccagccattttcaggctaatagctcgtcagcttgctaaaatccatgctatt
catgcacacaatggctggatccccaaatctaatctttggctaaagatgggaaagtatttc
tctctcattcccacaggatttgcagatgaagacattaataaaaggttcctaagtgatatc
ccaagctctcagattctccaggaagagatgacttggatgaaggagattctttccaacctg
ggctcacctgttgtgctttgccataatgacctattgtgtaagaatataatctacaatgag
aaacaaggtgatgtacagttcattgattatgaatattctggatacaactacctggcatat
gatattggaaatcatttcaatgaatttgcaggtgtgagtgatgtagactatagtctgtat
ccagatagagaactacagagtcagtggctgcgtgcttaccttgaagcctacaaagaattt
aagggctttgggactgaagttactgaaaaggaggtagaaatactcttcattcaagtcaat
cagtttgcattggcttctcatttcttttggggattgtgggctttgattcaagccaaatac
tccactattgagtttgatttccttgggtatgcaattgttcgttttaaccagtactttaaa
atgaagcctgaggttactgcattaaaagtgcctgagtaa

DBGET integrated database retrieval system