KEGG   Homo sapiens (human): 5551Help
Entry
5551              CDS       T01001                                 

Gene name
PRF1, FLH2, HPLH2, P1, PFN1, PFP
Definition
(RefSeq) perforin 1
  KO
K07818  
perforin 1
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Disease
H00109  
Familial hemophagocytic lymphohistiocytosis (FHPL)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    5551 (PRF1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5551 (PRF1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    5551 (PRF1)
   05330 Allograft rejection
    5551 (PRF1)
   05332 Graft-versus-host disease
    5551 (PRF1)
  Cardiovascular diseases
   05416 Viral myocarditis
    5551 (PRF1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    5551 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
10q22
AA seq 555 aa AA seqDB search
MAARLLLLGILLLLLPLPVPAPCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFP
VDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARD
AARSIRNDWKVGLDVTPKPTSNVHVSVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYS
FHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALR
TCELALEGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERH
SEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREAL
RRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVT
FIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGGPLRL
QVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQ
MLLGEPPGNRSGAVW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccgtctgctcctcctgggcatccttctcctgctgctgcccctgcccgtccct
gccccgtgccacacagccgcacgctcagagtgcaagcgcagccacaagttcgtgcctggt
gcatggctggccggggagggtgtggacgtgaccagcctccgccgctcgggctccttccca
gtggacacacaaaggttcctgcggcccgacggcacctgcaccctctgtgaaaatgcccta
caggagggcaccctccagcgcctgcctctggcgctcaccaactggcgggcccagggctct
ggctgccagcgccatgtaaccagggccaaagtcagctccactgaagctgtggcccgggat
gcggctcgtagcatccgcaacgactggaaggtcgggctggacgtgactcctaagcccacc
agcaatgtgcatgtgtctgtggccggctcacactcacaggcagccaactttgcagcccag
aagacccaccaggaccagtacagcttcagcactgacacggtggagtgccgcttctacagt
ttccatgtggtacacactcccccgctgcaccctgacttcaagagggccctcggggacctg
ccccaccacttcaacgcctccacccagcccgcctacctcaggcttatctccaactacggc
acccacttcatccgggctgtggagctgggtggccgcatatcggccctcactgccctgcgc
acctgcgagctggccctggaagggctcacggacaacgaggtggaggactgcctgactgtc
gaggcccaggtcaacataggcatccacggcagcatctctgccgaagccaaggcctgtgag
gagaagaagaagaagcacaagatgacggcctccttccaccaaacctaccgggagcgccac
tcggaagtggttggcggccatcacacctccattaacgacctgctgttcgggatccaggcc
gggcccgagcagtactcagcctgggtaaactcgctgcccggcagccctggcctggtggac
tacaccctggaacccctgcacgtgctgctggacagccaggacccgcggcgggaggcactg
aggagggccctgagtcagtacctgacggacagggctcgctggagggactgcagccggccg
tgcccaccagggcggcagaagagcccccgagacccatgccagtgtgtgtgccatggctca
gcggtcaccacccaggactgctgccctcggcagaggggcctggcccagctggaggtgacc
ttcatccaagcatggggcctgtggggggactggttcactgccacggatgcctatgtgaag
ctcttctttggtggccaggagctgaggacgagcaccgtgtgggacaataacaaccccatc
tggtcagtgcggctggattttggggatgtgctcctggccacaggggggcccctgaggttg
caggtctgggatcaggactctggcagggacgatgacctccttggcacctgtgatcaggct
cccaagtctggttcccatgaggtgagatgcaacctgaatcatggccacctaaaattccgc
tatcatgccaggtgcttgccccacctgggaggaggcacctgcctggactatgtcccccaa
atgcttctgggggagcctccaggaaaccggagtggggccgtgtggtga

DBGET integrated database retrieval system