KEGG   Homo sapiens (human): 55650Help
Entry
55650             CDS       T01001                                 

Gene name
PIGV, GPI-MT-II, HPMRS1, PIG-V
Definition
phosphatidylinositol glycan anchor biosynthesis, class V
Orthology
K07542  
phosphatidylinositol glycan, class V [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Metabolic pathways
Module
GPI-anchor biosynthesis, core oligosaccharide
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    55650 (PIGV)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     55650 (PIGV)
Glycosyltransferases [BR:hsa01003]
 GPI-anchor biosynthesis
  Core oligosaccharide
   55650 (PIGV)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
1p36.11
AA seq 493 aa AA seqDB search
MWPQDPSRKEVLRFAVSCRILTLMLQALFNAIIPDHHAEAFSPPRLAPSGFVDQLVEGLL
GGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTELLRPLRGLLSLRSCLLISVA
SLNFLFFMLAAVALHDLGCLVLHCPHQSFYAALLFCLSPANVFLAAGYSEALFALLTFSA
MGQLERGRVWTSVLLFAFATGVRSNGLVSVGFLMHSQCQGFFSSLTMLNPLRQLFKLMAS
LFLSVFTLGLPFALFQYYAYTQFCLPGSARPIPEPLVQLAVDKGYRIAEGNEPPWCFWDV
PLIYSYIQDVYWNVGFLKYYELKQVPNFLLAAPVAILVAWATWTYVTTHPWLCLTLGLQR
SKNNKTLEKPDLGFLSPQVFVYVVHAAVLLLFGGLCMHVQVLTRFLGSSTPIMYWFPAHL
LQDQEPLLRSLKTVPWKPLAEDSPPGQKVPRNPIMGLLYHWKTCSPVTRYILGYFLTYWL
LGLLLHCNFLPWT
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtggccccaggacccatcccggaaggaggtgctgaggtttgcagtcagctgccgtatc
ctgactctgatgctgcaggccctcttcaatgccatcatcccagatcaccatgcagaagcc
ttctctcctcctcgcctggccccctcaggctttgtggaccaactcgtggaaggtcttctg
ggcggcctgtctcactgggatgctgaacacttcttgttcattgctgagcatggctacctg
tatgagcacaactttgccttctttcctggtttccccttggccctgctggtggggactgaa
ctgttgagacccttacgggggttactgagtctacgcagttgcctgctgatttcggtagca
tcactcaatttcttgttcttcatgttggctgcagttgcacttcatgacctgggttgtctg
gttttgcactgtccccaccagtccttttatgcagctctgcttttctgtctcagccctgcc
aatgtcttcctggcagctggttactcagaagctttgtttgccctcctgacattcagtgcc
atggggcagctggagaggggccgagtctggactagtgtactcctctttgcctttgccact
ggggtacgctccaacgggctggtcagtgttggcttcctcatgcattctcaatgccaaggc
tttttctcttctctaacgatgctgaatcctctgagacagctctttaagctgatggcctct
ctgtttctgtcggtgttcacacttggccttccctttgccctctttcagtattatgcctac
acccaattctgtctgccaggctcagcccgccccattcctgagcctttggtacagttagct
gtagacaagggctaccggattgcagagggaaatgaaccgccttggtgcttctgggatgtt
ccactaatatacagctatatccaggatgtctactggaatgttggctttttgaaatactat
gagctcaagcaggtgcccaattttctactggctgcaccagtggctatactggttgcctgg
gcaacttggacatacgtgaccactcacccttggctctgccttacacttgggctgcaaagg
agcaagaacaataagaccctagagaagcccgatcttggattcctcagtcctcaggtgttt
gtgtacgtggtccacgctgcagtgctgctgctgtttggaggtctgtgcatgcatgttcag
gttctcaccaggtttttgggctcctccactcctattatgtactggtttccagctcacttg
cttcaggatcaagagccgctgttgagatccttaaagactgtgccttggaagcctcttgca
gaggactccccaccaggacaaaaggtccccagaaatcctatcatgggacttttgtatcac
tggaaaacctgttctccagtcacacgatacattctaggctacttcctgacttactggctc
ctgggactactcctacattgcaacttcctgccttggacatga

DBGET integrated database retrieval system