KEGG   Homo sapiens (human): 55703Help
Entry
55703             CDS       T01001                                 

Gene name
POLR3B, C128, HLD8, RPC2
Definition
polymerase (RNA) III (DNA directed) polypeptide B (EC:2.7.7.6)
Orthology
K03021  
DNA-directed RNA polymerase III subunit RPC2 [EC:2.7.7.6]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Cytosolic DNA-sensing pathway
Epstein-Barr virus infection
Module
RNA polymerase III, eukaryotes
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
Genetic Information Processing; Transcription; RNA polymerase [PATH:hsa03020]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:hsa04623]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
12q23.3
AA seq 1075 aa AA seqDB search
MKANEKVTSDADPMWYLKYLNIYVGLPDVEESFNVTRPVSPHECRLRDMTYSAPITVDIE
YTRGSQRIIRNALPIGRMPIMLRSSNCVLTGKTPAEFAKLNECPLDPGGYFIVKGVEKVI
LIQEQLSKNRIIVEADRKGAVGASVTSSTHEKKSRTNMAVKQGRFYLRHNTLSEDIPIVI
IFKAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQKAQIFTQMQALKYIGNKVRRQRMWG
GGPKKTKIEEARELLASTILTHVPVKEFNFRAKCIYTAVMVRRVILAQGDNKVDDRDYYG
NKRLELAGQLLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNA
ISTGNWSLKRFKMDRQGVTQVLSRLSYISALGMMTRISSQFEKTRKVSGPRSLQPSQWGM
LCPSDTPEGEACGLVKNLALMTHITTDMEDGPIVKLASNLGVEDVNLLCGEELSYPNVFL
VFLNGNILGVIRDHKKLVNTFRLMRRAGYINEFVSISTNLTDRCVYISSDGGRLCRPYII
VKKQKPAVTNKHMEELAQGYRNFEDFLHESLVEYLDVNEENDCNIALYEHTINKDTTHLE
IEPFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQKP
MVKTKTIELIEFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCT
LKRYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQI
PLEGSNVPQQPQYKDVPITYKGATDSYIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFS
SRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRF
HYGTAFGGSKVKDVCEDLVRHGYNYLGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLD
KMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVD
VCGQCGLLGYSGWCHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRLKLSKYNE
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccaatgaaaaggttacaagtgacgctgaccctatgtggtacttaaaatatctt
aatatctatgttgggcttcctgatgttgaagaaagcttcaatgtaactagaccagtgtcc
cctcatgagtgccgtttgagagacatgacatactctgcccctattacagtggatattgaa
tatacccgaggcagccagaggatcatccgcaatgccttacctatcggcagaatgcccata
atgctacgtagttcaaactgtgttcttacaggaaaaacgccagcagaatttgccaaactg
aacgaatgtcccttagatccaggtggctacttcattgttaaaggagtagaaaaagttatt
cttatccaagagcagctgtctaagaacaggatcatcgtggaggctgatagaaaaggggct
gttggagcttcagttaccagctctacccatgagaaaaaaagcagaaccaatatggctgtg
aaacaaggacgattttatttgaggcataatactttgtcagaagatatacccattgtcatc
atatttaaggccatgggtgttgagagtgaccaggaaattgtgcagatgattggaacagag
gagcacgtgatggctgcatttgggcccagtctggaagagtgccagaaagctcagattttc
acacagatgcaggcattaaaatatatagggaacaaagtaagaaggcaaaggatgtgggga
ggtggaccaaagaaaaccaaaatagaagaagcaagagagctcctggcttccaccattctg
acccatgtcccagttaaggaattcaatttccgagccaaatgtatctatactgcagtgatg
gtgcgaagagttattctggcccaaggagataataaagttgacgacagagattattatggt
aacaagcgactggaattggcaggacagcttttatctcttctttttgaagacttgttcaaa
aaatttaattctgaaatgaaaaagattgccgaccaggtgattcctaagcaaagagcagcc
cagtttgatgttgtcaaacacatgcgccaagaccagatcaccaatggcatggtgaatgct
atttctaccggaaattggtctttaaagagatttaaaatggaccgccagggtgtaacccaa
gtgctgtctcgcttgtcatatatatccgcactgggcatgatgacaagaatctcttcccag
tttgaaaaaacgagaaaagtgagtggtcctcgctccctccagccatctcagtggggaatg
ctgtgtccttcggacactcctgaaggagaggcatgtggtttggttaaaaacttggccctt
atgacacacatcacaactgatatggaagatggacccattgttaaattagccagtaacttg
ggagtagaagatgtgaatttattatgtggggaagagctctcttacccaaatgtgtttctt
gtctttcttaatggtaacatcttaggtgtcattcgagaccacaaaaagctagtgaataca
tttcgactcatgagaagagcaggatatatcaatgaatttgtttccatctcaacaaatctt
acagatcgatgtgtctatatttcttctgatgggggaaggctatgcagaccctacataatt
gtcaagaaacagaagccagcagtcacaaataaacatatggaagagctggcccaagggtac
aggaattttgaagatttcttacatgagagtctggttgaatatttagatgtgaatgaagaa
aatgattgtaacattgcactgtacgaacacacaattaataaagacaccacccacttggag
attgaacccttcactcttctcggcgtgtgtgctggacttatcccataccctcaccataac
cagtcaccgagaaacacttatcagtgtgccatggggaaacaagccatgggtactatagga
tacaaccagcgaaacagaattgatactctcatgtatctactagcatatccacaaaaaccc
atggttaagacaaaaaccattgaattgatagaatttgagaaactgccagctggacagaat
gcaacagttgctgtgatgagctatagtggctatgatattgaagatgctcttgttttaaac
aaggcctctttagacagaggctttgggcgttgccttgtatataaaaatgctaaatgtacg
ttgaaacgatacaccaatcagacttttgataaagtgatggggcccatgttggatgctgct
acaaggaaacctatctggcgacatgaaatcttagatgcagatggtatttgttctccaggt
gagaaagtagaaaacaaacaagtgcttgtaaataagtccatgcccacagtgactcagatt
cctttggaaggaagtaatgtaccacagcaaccacagtacaaagatgtacccataacctac
aaaggagcaacagactcatatattgaaaaagtgatgatatcttcaaatgctgaagatgct
tttctgatcaaaatgctgctgagacagacaaggcgtccagaaattggagacaaattcagc
agtcgtcatgggcaaaaaggtgtttgtggcttgatcgtcccccaggaagacatgccattt
tgtgattctggcatctgtccggacatcatcatgaacccacacggcttcccatcacgaatg
acggtggggaagctcattgagctgctggctggcaaggccggtgtgctggacggcagattc
cactacggcactgcgtttggaggcagtaaagtgaaggatgtgtgtgaggacctcgttcgc
catggttataactacttggggaaagactatgttacatccggcatcacaggtgagccctta
gaagcatacatctattttggccccgtgtactatcagaagctgaaacacatggtgctagat
aaaatgcatgcccgggcccggggcccacgagccgtccttaccaggcaacccactgaagga
cggtctcgtgatggtggcttgcgtctcggggaaatggaacgtgactgtttaatcggttat
ggagccagtatgcttttgctagagagactaatgatttcaagtgatgcctttgaggttgat
gtctgtgggcagtgtggacttctggggtattctggctggtgccattactgcaagtcatcc
tgccacgtgtcttccctccgtattccgtatgcctgcaagctgctcttccaggaactacag
tctatgaacatcatccccaggttaaaactgtccaagtacaatgaatga

DBGET integrated database retrieval system