KEGG   Homo sapiens (human): 55703Help
Entry
55703             CDS       T01001                                 

Gene name
POLR3B, C128, HLD8, INMAP, RPC2
Definition
(RefSeq) RNA polymerase III subunit B (EC:2.7.7.6)
  KO
K03021  
DNA-directed RNA polymerase III subunit RPC2 [EC:2.7.7.6]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Cytosolic DNA-sensing pathway
Epstein-Barr virus infection
Module
RNA polymerase III, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    55703 (POLR3B)
   00240 Pyrimidine metabolism
    55703 (POLR3B)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    55703 (POLR3B)
 Organismal Systems
  Immune system
   04623 Cytosolic DNA-sensing pathway
    55703 (POLR3B)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    55703 (POLR3B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     55703 (POLR3B)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     55703 (POLR3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
12q23.3
AA seq 1133 aa AA seqDB search
MDVLAEEFGNLTPEQLAAPIPTVEEKWRLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMK
ANEKVTSDADPMWYLKYLNIYVGLPDVEESFNVTRPVSPHECRLRDMTYSAPITVDIEYT
RGSQRIIRNALPIGRMPIMLRSSNCVLTGKTPAEFAKLNECPLDPGGYFIVKGVEKVILI
QEQLSKNRIIVEADRKGAVGASVTSSTHEKKSRTNMAVKQGRFYLRHNTLSEDIPIVIIF
KAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQKAQIFTQMQALKYIGNKVRRQRMWGGG
PKKTKIEEARELLASTILTHVPVKEFNFRAKCIYTAVMVRRVILAQGDNKVDDRDYYGNK
RLELAGQLLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAIS
TGNWSLKRFKMDRQGVTQVLSRLSYISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLC
PSDTPEGEACGLVKNLALMTHITTDMEDGPIVKLASNLGVEDVNLLCGEELSYPNVFLVF
LNGNILGVIRDHKKLVNTFRLMRRAGYINEFVSISTNLTDRCVYISSDGGRLCRPYIIVK
KQKPAVTNKHMEELAQGYRNFEDFLHESLVEYLDVNEENDCNIALYEHTINKDTTHLEIE
PFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQKPMV
KTKTIELIEFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLK
RYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPL
EGSNVPQQPQYKDVPITYKGATDSYIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSR
HGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHY
GTAFGGSKVKDVCEDLVRHGYNYLGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKM
HARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVC
GQCGLLGYSGWCHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRLKLSKYNE
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgctagcggaggagtttgggaacctgactccggagcagctggcggcgccgatc
ccgactgtagaggaaaaatggaggctgcttccagcatttttaaaggtgaaaggccttgtg
aaacagcatatagattcatttaactatttcattaatgtagagataaagaagataatgaaa
gccaatgaaaaggttacaagtgacgctgaccctatgtggtacttaaaatatcttaatatc
tatgttgggcttcctgatgttgaagaaagcttcaatgtaactagaccagtgtcccctcat
gagtgccgtttgagagacatgacatactctgcccctattacagtggatattgaatatacc
cgaggcagccagaggatcatccgcaatgccttacctatcggcagaatgcccataatgcta
cgtagttcaaactgtgttcttacaggaaaaacgccagcagaatttgccaaactgaacgaa
tgtcccttagatccaggtggctacttcattgttaaaggagtagaaaaagttattcttatc
caagagcagctgtctaagaacaggatcatcgtggaggctgatagaaaaggggctgttgga
gcttcagttaccagctctacccatgagaaaaaaagcagaaccaatatggctgtgaaacaa
ggacgattttatttgaggcataatactttgtcagaagatatacccattgtcatcatattt
aaggccatgggtgttgagagtgaccaggaaattgtgcagatgattggaacagaggagcac
gtgatggctgcatttgggcccagtctggaagagtgccagaaagctcagattttcacacag
atgcaggcattaaaatatatagggaacaaagtaagaaggcaaaggatgtggggaggtgga
ccaaagaaaaccaaaatagaagaagcaagagagctcctggcttccaccattctgacccat
gtcccagttaaggaattcaatttccgagccaaatgtatctatactgcagtgatggtgcga
agagttattctggcccaaggagataataaagttgacgacagagattattatggtaacaag
cgactggaattggcaggacagcttttatctcttctttttgaagacttgttcaaaaaattt
aattctgaaatgaaaaagattgccgaccaggtgattcctaagcaaagagcagcccagttt
gatgttgtcaaacacatgcgccaagaccagatcaccaatggcatggtgaatgctatttct
accggaaattggtctttaaagagatttaaaatggaccgccagggtgtaacccaagtgctg
tctcgcttgtcatatatatccgcactgggcatgatgacaagaatctcttcccagtttgaa
aaaacgagaaaagtgagtggtcctcgctccctccagccatctcagtggggaatgctgtgt
ccttcggacactcctgaaggagaggcatgtggtttggttaaaaacttggcccttatgaca
cacatcacaactgatatggaagatggacccattgttaaattagccagtaacttgggagta
gaagatgtgaatttattatgtggggaagagctctcttacccaaatgtgtttcttgtcttt
cttaatggtaacatcttaggtgtcattcgagaccacaaaaagctagtgaatacatttcga
ctcatgagaagagcaggatatatcaatgaatttgtttccatctcaacaaatcttacagat
cgatgtgtctatatttcttctgatgggggaaggctatgcagaccctacataattgtcaag
aaacagaagccagcagtcacaaataaacatatggaagagctggcccaagggtacaggaat
tttgaagatttcttacatgagagtctggttgaatatttagatgtgaatgaagaaaatgat
tgtaacattgcactgtacgaacacacaattaataaagacaccacccacttggagattgaa
cccttcactcttctcggcgtgtgtgctggacttatcccataccctcaccataaccagtca
ccgagaaacacttatcagtgtgccatggggaaacaagccatgggtactataggatacaac
cagcgaaacagaattgatactctcatgtatctactagcatatccacaaaaacccatggtt
aagacaaaaaccattgaattgatagaatttgagaaactgccagctggacagaatgcaaca
gttgctgtgatgagctatagtggctatgatattgaagatgctcttgttttaaacaaggcc
tctttagacagaggctttgggcgttgccttgtatataaaaatgctaaatgtacgttgaaa
cgatacaccaatcagacttttgataaagtgatggggcccatgttggatgctgctacaagg
aaacctatctggcgacatgaaatcttagatgcagatggtatttgttctccaggtgagaaa
gtagaaaacaaacaagtgcttgtaaataagtccatgcccacagtgactcagattcctttg
gaaggaagtaatgtaccacagcaaccacagtacaaagatgtacccataacctacaaagga
gcaacagactcatatattgaaaaagtgatgatatcttcaaatgctgaagatgcttttctg
atcaaaatgctgctgagacagacaaggcgtccagaaattggagacaaattcagcagtcgt
catgggcaaaaaggtgtttgtggcttgatcgtcccccaggaagacatgccattttgtgat
tctggcatctgtccggacatcatcatgaacccacacggcttcccatcacgaatgacggtg
gggaagctcattgagctgctggctggcaaggccggtgtgctggacggcagattccactac
ggcactgcgtttggaggcagtaaagtgaaggatgtgtgtgaggacctcgttcgccatggt
tataactacttggggaaagactatgttacatccggcatcacaggtgagcccttagaagca
tacatctattttggccccgtgtactatcagaagctgaaacacatggtgctagataaaatg
catgcccgggcccggggcccacgagccgtccttaccaggcaacccactgaaggacggtct
cgtgatggtggcttgcgtctcggggaaatggaacgtgactgtttaatcggttatggagcc
agtatgcttttgctagagagactaatgatttcaagtgatgcctttgaggttgatgtctgt
gggcagtgtggacttctggggtattctggctggtgccattactgcaagtcatcctgccac
gtgtcttccctccgtattccgtatgcctgcaagctgctcttccaggaactacagtctatg
aacatcatccccaggttaaaactgtccaagtacaatgaatga

DBGET integrated database retrieval system