KEGG   Homo sapiens (human): 5580Help
Entry
5580              CDS       T01001                                 

Gene name
PRKCD, CVID9, MAY1, PKCD, nPKC-delta
Definition
protein kinase C, delta (EC:2.7.10.2 2.7.11.13)
Orthology
K06068  
novel protein kinase C delta type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Vascular smooth muscle contraction
Tight junction
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Estrogen signaling pathway
Type II diabetes mellitus
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    5580 (PRKCD)
 Organismal Systems
  Immune system
   04664 Fc epsilon RI signaling pathway
    5580 (PRKCD)
   04666 Fc gamma R-mediated phagocytosis
    5580 (PRKCD)
   04062 Chemokine signaling pathway
    5580 (PRKCD)
  Endocrine system
   04912 GnRH signaling pathway
    5580 (PRKCD)
   04915 Estrogen signaling pathway
    5580 (PRKCD)
  Circulatory system
   04270 Vascular smooth muscle contraction
    5580 (PRKCD)
  Nervous system
   04722 Neurotrophin signaling pathway
    5580 (PRKCD)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5580 (PRKCD)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    5580 (PRKCD)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5580 (PRKCD)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   5580 (PRKCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3p21.31
AA seq 676 aa AA seqDB search
MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASR
RSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSF
GKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK
DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVL
LDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYE
MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIH
PFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAF
AGFSFVNPKFEHLLED
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgttcctgcgcatcgccttcaactcctatgagctgggctccctgcaggccgag
gacgaggcgaaccagcccttctgtgccgtgaagatgaaggaggcgctcagcacagagcgt
gggaaaacactggtgcagaagaagccgaccatgtatcctgagtggaagtcgacgttcgat
gcccacatctatgaggggcgcgtcatccagattgtgctaatgcgggcagcagaggagcca
gtgtctgaggtgaccgtgggtgtgtcggtgctggccgagcgctgcaagaagaacaatggc
aaggctgagttctggctggacctgcagcctcaggccaaggtgttgatgtctgttcagtat
ttcctggaggacgtggattgcaaacagtctatgcgcagtgaggacgaggccaagttccca
acgatgaaccgccgcggagccatcaaacaggccaaaatccactacatcaagaaccatgag
tttatcgccaccttctttgggcaacccaccttctgttctgtgtgcaaagactttgtctgg
ggcctcaacaagcaaggctacaaatgcaggcaatgtaacgctgccatccacaagaaatgc
atcgacaagatcatcggcagatgcactggcaccgcggccaacagccgggacactatattc
cagaaagaacgcttcaacatcgacatgccgcaccgcttcaaggttcacaactacatgagc
cccaccttctgtgaccactgcggcagcctgctctggggactggtgaagcagggattaaag
tgtgaagactgcggcatgaatgtgcaccataaatgccgggagaaggtggccaacctctgc
ggcatcaaccagaagcttttggctgaggccttgaaccaagtcacccagagagcctcccgg
agatcagactcagcctcctcagagcctgttgggatatatcagggtttcgagaagaagacc
ggagttgctggggaggacatgcaagacaacagtgggacctacggcaagatctgggagggc
agcagcaagtgcaacatcaacaacttcatcttccacaaggtcctgggcaaaggcagcttc
gggaaggtgctgcttggagagctgaagggcagaggagagtactttgccatcaaggccctc
aagaaggatgtggtcctgatcgacgacgacgtggagtgcaccatggttgagaagcgggtg
ctgacacttgccgcagagaatccctttctcacccacctcatctgcaccttccagaccaag
gaccacctgttctttgtgatggagttcctcaacgggggggacctgatgtaccacatccag
gacaaaggccgctttgaactctaccgtgccacgttttatgccgctgagataatgtgtgga
ctgcagtttctacacagcaagggcatcatttacagggacctcaaactggacaatgtgctg
ctggaccgggatggccacatcaagattgccgactttgggatgtgcaaagagaacatattc
ggggagagccgggccagcaccttctgcggcacccctgactatatcgcccctgagatccta
cagggcctgaagtacacattctctgtggactggtggtctttcggggtccttctgtacgag
atgctcattggccagtcccccttccatggtgatgatgaggatgaactcttcgagtccatc
cgtgtggacacgccacattatccccgctggatcaccaaggagtccaaggacatcctggag
aagctctttgaaagggaaccaaccaagaggctgggagtgaccggaaacatcaaaatccac
cccttcttcaagaccataaactggactctgctggaaaagcggaggttggagccacctttc
aggcccaaagtgaagtcacccagagactacagtaactttgaccaggagttcctgaacgag
aaggcgcgcctctcctacagcgacaagaacctcatcgactccatggaccagtctgcattc
gctggcttctcctttgtgaaccccaaattcgagcacctcctggaagattga

DBGET integrated database retrieval system