KEGG   Homo sapiens (human): 5586Help
Entry
5586              CDS       T01001                                 

Gene name
PKN2, PAK2, PRK2, PRKCL2, PRO2042, Pak-2, STK7
Definition
protein kinase N2 (EC:2.7.11.13)
Orthology
K06071  
protein kinase N [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    5586 (PKN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    5586 (PKN2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5586 (PKN2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKN family
   5586 (PKN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1p22.2
AA seq 984 aa AA seqDB search
MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKEL
KIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKLQELNAHIVVSDPEDITDCPR
TPDTPNNDPRCSTSNNRLKALQKQLDIELKVKQGAENMIQMYSNGSSKDRKLHGTAQQLL
QDSKTKIEVIRMQILQAVQTNELAFDNAKPVISPLELRMEELRHHFRIEFAVAEGAKNVM
KLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNEVPKNHPKSRIIIEELSLVA
ASPTLSPRQSMISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWS
PSETRSSFMSRTSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQSWDQK
FTLELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAEVTFFN
PVIERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQAPV
PTTVPVVDVRIPQLAPPASDSTVTKLDFDLEPEPPPAPPRASSLGEIDESSELRVLDIPG
QDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCC
AVLGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFL
VNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVY
RDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDW
WGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRL
GASEKDAEDVKKHPFFRLIDWSALMDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPP
REPRILSEEEQEMFRDFDYIADWC
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaccccgaacggggggagattctgctcacggaactgcagggggattcccga
agtcttccgttttctgagaatgtgagtgctgttcaaaaattagacttttcagatacaatg
gtgcagcagaaattggatgatatcaaggatcgaattaagagagaaataaggaaagaactg
aaaatcaaagaaggagctgaaaatctgaggaaagtcacaacagataaaaaaagtttggct
tatgtagacaacattttgaaaaaatcaaataaaaaattagaagaactacatcacaagctg
caggaattaaatgcacatattgttgtatcagatccagaagatattacagattgcccaagg
actccagatactccaaataatgaccctcgttgttctactagcaacaatagattgaaggcc
ttacaaaaacaattggatatagaacttaaagtaaaacaaggtgcagagaatatgatacag
atgtattcaaatggatcttcaaaggatcggaaactccatggtacagctcagcaactgctc
caggacagcaagacaaaaatagaagtcatacgaatgcagattcttcaggcagtccagact
aatgaattggcttttgataatgcaaaacctgtgataagtcctcttgaacttcggatggaa
gaattaaggcatcattttaggatagagtttgcagtagcagaaggtgcaaagaatgtaatg
aaattacttggctcaggaaaagtaacagacagaaaagcactttcagaagctcaagcaaga
tttaatgaatcaagtcagaagttggaccttttaaagtattcattagagcaaagattaaac
gaagtccccaagaatcatcccaaaagcaggattattattgaagaactttcacttgttgct
gcatcaccaacactaagtccacgtcaaagtatgatatctacgcaaaatcaatatagtaca
ctatccaaaccagcagcactaacaggtactttggaagttcgtcttatgggctgccaagat
atcctagagaatgtccctggacggtcaaaagcaacatcagttgcactgcctggttggagt
ccaagtgaaaccagatcatctttcatgagcagaacgagtaaaagtaaaagcggaagtagt
cgaaatcttctaaaaaccgatgacttgtccaatgatgtctgtgctgttttgaagctcgat
aatactgtggttggccaaactagctggaaacccatttccaatcagtcatgggaccagaag
tttacactggaactggacaggtcacgtgaactggaaatttcagtttattggcgtgattgg
cggtctctgtgtgctgtaaaatttctgaggttagaagattttttagacaaccaacggcat
ggcatgtgtctctatttggaaccacagggtactttatttgcagaggttaccttttttaat
ccagttattgaaagaagaccaaaacttcaaagacaaaagaaaattttttcaaagcaacaa
ggcaaaacatttctcagagctcctcaaatgaatattaatattgccacttggggaaggcta
gtaagaagagctattcctacagtaaatcattctggcaccttcagccctcaagctcctgtg
cctactacagtgccagtggttgatgtacgcatccctcaactagcacctccagctagtgat
tctacagtaaccaaattggactttgatcttgagcctgaacctcctccagccccaccacga
gcttcttctcttggagaaatagatgaatcttctgaattaagagttttggatataccagga
caggattcagagactgtttttgatattcagaatgacagaaatagtatacttccaaaatct
caatctgaatacaagcctgatactcctcagtcaggcctagaatatagtggtattcaagaa
cttgaggacagaagatctcagcaaaggtttcagtttaatctacaagatttcaggtgttgt
gctgtcttgggaagaggacattttggaaaggtgcttttagctgaatataaaaacacaaat
gagatgtttgctataaaagccttaaagaaaggagatattgtggctcgagatgaagtagac
agcctgatgtgtgaaaaaagaatttttgaaactgtgaatagtgtaaggcatccctttttg
gtgaacctttttgcatgtttccaaaccaaagagcatgtttgctttgtaatggaatatgct
gccggtggggacctaatgatgcacattcatactgatgtcttttctgaaccaagagctgta
ttttatgctgcttgtgtagttcttgggttgcagtatttacatgaacacaaaattgtttat
agagatttgaaattggataacttattgctagatacagagggctttgtgaaaattgctgat
tttggtctttgcaaagaaggaatgggatatggagatagaacaagcacattttgtggcact
cctgaatttcttgccccagaagtattaacagaaacttcttatacaagggctgtagattgg
tggggccttggcgtgcttatatatgaaatgcttgttggtgagtctccctttcctggtgat
gatgaagaggaagtttttgacagtattgtaaatgatgaagtaaggtatccaaggttctta
tctacagaagccatttctataatgagaaggctgttaagaagaaatcctgaacggcgcctt
ggggctagcgagaaagatgcagaggatgtaaaaaagcacccatttttccggctaattgat
tggagcgctctgatggacaaaaaagtaaagccaccatttatacctaccataagaggacga
gaagatgttagtaattttgatgatgaatttacctcagaagcacctattctgactccacct
cgagaaccaaggatactttcggaagaggagcaggaaatgttcagagattttgactacatt
gctgattggtgttaa

DBGET integrated database retrieval system