KEGG   Homo sapiens (human): 5627Help
Entry
5627              CDS       T01001                                 

Gene name
PROS1, PROS, PS21, PS22, PS23, PS24, PS25, PSA, THPH5, THPH6
Definition
protein S (alpha)
Orthology
K03908  
protein S
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Disease
H00223  
Inherited thrombophilia
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3q11.2
AA seq 676 aa AA seqDB search
MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLLEETKQGNLERECIE
ELCNKEEAREVFENDPETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQ
CSPLPCNEDGYMSCKDGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPG
SYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKS
CEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
YLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWLLIALRGGKIE
VQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGL
LETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVE
KGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLV
DSTSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETISHEDL
QRQLAVLDKAMKAKVATYLGGLPDVPFSATPVNAFYNGCMEVNINGVQLDLDEAISKHND
IRAHSCPSVWKKTKNS
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcctgggtgggcgctgcggggcgctgctggcgtgtctcctcctagtgcttccc
gtctcagaggcaaactttttgtcaaagcaacaggcttcacaagtcctggttaggaagcgt
cgtgcaaattctttacttgaagaaaccaaacagggtaatcttgaaagagaatgcatcgaa
gaactgtgcaataaagaagaagccagggaggtctttgaaaatgacccggaaacggattat
ttttatccaaaatacttagtttgtcttcgctcttttcaaactgggttattcactgctgca
cgtcagtcaactaatgcttatcctgacctaagaagctgtgtcaatgccattccagaccag
tgtagtcctctgccatgcaatgaagatggatatatgagctgcaaagatggaaaagcttct
tttacttgcacttgtaaaccaggttggcaaggagaaaagtgtgaatttgacataaatgaa
tgcaaagatccctcaaatataaatggaggttgcagtcaaatttgtgataatacacctgga
agttaccactgttcctgtaaaaatggttttgttatgctttcaaataagaaagattgtaaa
gatgtggatgaatgctctttgaagccaagcatttgtggcacagctgtgtgcaagaacatc
ccaggagattttgaatgtgaatgccccgaaggctacagatataatctcaaatcaaagtct
tgtgaagatatagatgaatgctctgagaacatgtgtgctcagctttgtgtcaattaccct
ggaggttacacttgctattgtgatgggaagaaaggattcaaacttgcccaagatcagaag
agttgtgaggttgtttcagtgtgccttcccttgaaccttgacacaaagtatgaattactt
tacttggcggagcagtttgcaggggttgttttatatttaaaatttcgtttgccagaaatc
agcagattttcagcagaatttgatttccggacatatgattcagaaggcgtgatactgtac
gcagaatctatcgatcactcagcgtggctcctgattgcacttcgtggtggaaagattgaa
gttcagcttaagaatgaacatacatccaaaatcacaactggaggtgatgttattaataat
ggtctatggaatatggtgtctgtggaagaattagaacatagtattagcattaaaatagct
aaagaagctgtgatggatataaataaacctggacccctttttaagccggaaaatggattg
ctggaaaccaaagtatactttgcaggattccctcggaaagtggaaagtgaactcattaaa
ccgattaaccctcgtctagatggatgtatacgaagctggaatttgatgaagcaaggagct
tctggaataaaggaaattattcaagaaaaacaaaataagcattgcctggttactgtggag
aagggctcctactatcctggttctggaattgctcaatttcacatagattataataatgta
tccagtgctgagggttggcatgtaaatgtgaccttgaatattcgtccatccacgggcact
ggtgttatgcttgccttggtttctggtaacaacacagtgccctttgctgtgtccttggtg
gactccacctctgaaaaatcacaggatattctgttatctgttgaaaatactgtaatatat
cggatacaggccctaagtctatgttccgatcaacaatctcatctggaatttagagtcaac
agaaacaatctggagttgtcgacaccacttaaaatagaaaccatctcccatgaagacctt
caaagacaacttgccgtcttggacaaagcaatgaaagcaaaagtggccacatacctgggt
ggccttccagatgttccattcagtgccacaccagtgaatgccttttataatggctgcatg
gaagtgaatattaatggtgtacagttggatctggatgaagccatttctaaacataatgat
attagagctcactcatgtccatcagtttggaaaaagacaaagaattcttaa

DBGET integrated database retrieval system