KEGG   Homo sapiens (human): 5644Help
Entry
5644              CDS       T01001                                 

Gene name
PRSS1, TRP1, TRY1, TRY4, TRYP1
Definition
protease, serine, 1 (trypsin 1) (EC:3.4.21.4)
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Disease
H00933  
Hereditary pancreatitis
Drug target
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
7q34
AA seq 247 aa AA seqDB search
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgatccttacctttgtggcagctgctcttgctgccccctttgatgat
gatgacaagatcgttgggggctacaactgtgaggagaattctgtcccctaccaggtgtcc
ctgaattctggctaccacttctgtggtggctccctcatcaacgaacagtgggtggtatca
gcaggccactgctacaagtcccgcatccaggtgagactgggagagcacaacatcgaagtc
ctggaggggaatgagcagttcatcaatgcagccaagatcatccgccacccccaatacgac
aggaagactctgaacaatgacatcatgttaatcaagctctcctcacgtgcagtaatcaac
gcccgcgtgtccaccatctctctgcccaccgcccctccagccactggcacgaagtgcctc
atctctggctggggcaacactgcgagctctggcgccgactacccagacgagctgcagtgc
ctggatgctcctgtgctgagccaggctaagtgtgaagcctcctaccctggaaagattacc
agcaacatgttctgtgtgggcttccttgagggaggcaaggattcatgtcagggtgattct
ggtggccctgtggtctgcaatggacagctccaaggagttgtctcctggggtgatggctgt
gcccagaagaacaagcctggagtctacaccaaggtctacaactatgtgaaatggattaag
aacaccatagctgccaatagctaa

DBGET integrated database retrieval system