KEGG   Homo sapiens (human): 5644Help
Entry
5644              CDS       T01001                                 

Gene name
PRSS1, TRP1, TRY1, TRY4, TRYP1
Definition
protease, serine, 1 (trypsin 1) (EC:3.4.21.4)
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Disease
H00933  
Hereditary pancreatitis
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5644 (PRSS1)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    5644 (PRSS1)
   04974 Protein digestion and absorption
    5644 (PRSS1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    5644 (PRSS1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     5644 (PRSS1)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   5644 (PRSS1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5644 (PRSS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
7q34
AA seq 247 aa AA seqDB search
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgatccttacctttgtggcagctgctcttgctgccccctttgatgat
gatgacaagatcgttgggggctacaactgtgaggagaattctgtcccctaccaggtgtcc
ctgaattctggctaccacttctgtggtggctccctcatcaacgaacagtgggtggtatca
gcaggccactgctacaagtcccgcatccaggtgagactgggagagcacaacatcgaagtc
ctggaggggaatgagcagttcatcaatgcagccaagatcatccgccacccccaatacgac
aggaagactctgaacaatgacatcatgttaatcaagctctcctcacgtgcagtaatcaac
gcccgcgtgtccaccatctctctgcccaccgcccctccagccactggcacgaagtgcctc
atctctggctggggcaacactgcgagctctggcgccgactacccagacgagctgcagtgc
ctggatgctcctgtgctgagccaggctaagtgtgaagcctcctaccctggaaagattacc
agcaacatgttctgtgtgggcttccttgagggaggcaaggattcatgtcagggtgattct
ggtggccctgtggtctgcaatggacagctccaaggagttgtctcctggggtgatggctgt
gcccagaagaacaagcctggagtctacaccaaggtctacaactatgtgaaatggattaag
aacaccatagctgccaatagctaa

DBGET integrated database retrieval system