KEGG   Homo sapiens (human): 5649Help
Entry
5649              CDS       T01001                                 

Gene name
RELN, LIS2, PRO1598, RL
Definition
reelin
Orthology
K06249  
reelin [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Disease
H00268  
Lissencephaly (LIS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    5649 (RELN)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    5649 (RELN)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    5649 (RELN)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     5649 (RELN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
7q22
AA seq 3460 aa AA seqDB search
MERSGWARQTFLLALLLGATLRARAAAGYYPRFSPFFFLCTHHGELEGDGEQGEVLISLH
IAGNPTYYVPGQEYHVTISTSTFFDGLLVTGLYTSTSVQASQSIGGSSAFGFGIMSDHQF
GNQFMCSVVASHVSHLPTTNLSFIWIAPPAGTGCVNFMATATHRGQVIFKDALAQQLCEQ
GAPTDVTVHPHLAEIHSDSIILRDDFDSYHQLQLNPNIWVECNNCETGEQCGAIMHGNAV
TFCEPYGPRELITTGLNTTTASVLQFSIGSGSCRFSYSDPSIIVLYAKNNSADWIQLEKI
RAPSNVSTIIHILYLPEDAKGENVQFQWKQENLRVGEVYEACWALDNILIINSAHRQVVL
EDSLDPVDTGNWLFFPGATVKHSCQSDGNSIYFHGNEGSEFNFATTRDVDLSTEDIQEQW
SEEFESQPTGWDVLGAVIGTECGTIESGLSMVFLKDGERKLCTPSMDTTGYGNLRFYFVM
GGICDPGNSHENDIILYAKIEGRKEHITLDTLSYSSYKVPSLVSVVINPELQTPATKFCL
RQKNHQGHNRNVWAVDFFHVLPVLPSTMSHMIQFSINLGCGTHQPGNSVSLEFSTNHGRS
WSLLHTECLPEICAGPHLPHSTVYSSENYSGWNRITIPLPNAALTRNTRIRWRQTGPILG
NMWAIDNVYIGPSCLKFCSGRGQCTRHGCKCDPGFSGPACEMASQTFPMFISESFGSSRL
SSYHNFYSIRGAEVSFGCGVLASGKALVFNKDGRRQLITSFLDSSQSRFLQFTLRLGSKS
VLSTCRAPDQPGEGVLLHYSYDNGITWKLLEHYSYLSYHEPRIISVELPGDAKQFGIQFR
WWQPYHSSQREDVWAIDEIIMTSVLFNSISLDFTNLVEVTQSLGFYLGNVQPYCGHDWTL
CFTGDSKLASSMRYVETQSMQIGASYMIQFSLVMGCGQKYTPHMDNQVKLEYSTNHGLTW
HLVQEECLPSMPSCQEFTSASIYHASEFTQWRRVIVLLPQKTWSSATRFRWSQSYYTAQD
EWALDSIYIGQQCPNMCSGHGSCDHGICRCDQGYQGTECHPEAALPSTIMSDFENQNGWE
SDWQEVIGGEIVKPEQGCGVISSGSSLYFSKAGKRQLVSWDLDTSWVDFVQFYIQIGGES
ASCNKPDSREEGVLLQYSNNGGIQWHLLAEMYFSDFSKPRFVYLELPAAAKTPCTRFRWW
QPVFSGEDYDQWAVDDIIILSEKQKQIIPVINPTLPQNFYEKPAFDYPMNQMSVWLMLAN
EGMVKNETFCAATPSAMIFGKSDGDRFAVTRDLTLKPGYVLQFKLNIGCANQFSSTAPVL
LQYSHDAGMSWFLVKEGCYPASAGKGCEGNSRELSEPTMYHTGDFEEWTRITIVIPRSLA
SSKTRFRWIQESSSQKNVPPFGLDGVYISEPCPSYCSGHGDCISGVCFCDLGYTAAQGTC
VSNVPNHNEMFDRFEGKLSPLWYKITGAQVGTGCGTLNDGKSLYFNGPGKREARTVPLDT
RNIRLVQFYIQIGSKTSGITCIKPRTRNEGLIVQYSNDNGILWHLLRELDFMSFLEPQII
SIDLPQDAKTPATAFRWWQPQHGKHSAQWALDDVLIGMNDSSQTGFQDKFDGSIDLQANW
YRIQGGQVDIDCLSMDTALIFTENIGKPRYAETWDFHVSASTFLQFEMSMGCSKPFSNSH
SVQLQYSLNNGKDWHLVTEECVPPTIGCLHYTESSIYTSERFQNWKRITVYLPLSTISPR
TRFRWIQANYTVGADSWAIDNVVLASGCPWMCSGRGICDAGRCVCDRGFGGPYCVPVVPL
PSILKDDFNGNLHPDLWPEVYGAERGNLNGETIKSGTSLIFKGEGLRMLISRDLDCTNTM
YVQFSLRFIAKSTPERSHSILLQFSISGGITWHLMDEFYFPQTTNILFINVPLPYTAQTN
ATRFRLWQPYNNGKKEEIWIVDDFIIDGNNVNNPVMLLDTFDFGPREDNWFFYPGGNIGL
YCPYSSKGAPEEDSAMVFVSNEVGEHSITTRDLNVNENTIIQFEINVGCSTDSSSADPVR
LEFSRDFGATWHLLLPLCYHSSSHVSSLCSTEHHPSSTYYAGTMQGWRREVVHFGKLHLC
GSVRFRWYQGFYPAGSQPVTWAIDNVYIGPQCEEMCNGQGSCINGTKCICDPGYSGPTCK
ISTKNPDFLKDDFEGQLESDRFLLMSGGKPSRKCGILSSGNNLFFNEDGLRMLMTRDLDL
SHARFVQFFMRLGCGKGVPDPRSQPVLLQYSLNGGLSWSLLQEFLFSNSSNVGRYIALEI
PLKARSGSTRLRWWQPSENGHFYSPWVIDQILIGGNISGNTVLEDDFTTLDSRKWLLHPG
GTKMPVCGSTGDALVFIEKASTRYVVSTDVAVNEDSFLQIDFAASCSVTDSCYAIELEYS
VDLGLSWHPLVRDCLPTNVECSRYHLQRILVSDTFNKWTRITLPLPPYTRSQATRFRWHQ
PAPFDKQQTWAIDNVYIGDGCIDMCSGHGRCIQGNCVCDEQWGGLYCDDPETSLPTQLKD
NFNRAPSSQNWLTVNGGKLSTVCGAVASGMALHFSGGCSRLLVTVDLNLTNAEFIQFYFM
YGCLITPNNRNQGVLLEYSVNGGITWNLLMEIFYDQYSKPGFVNILLPPDAKEIATRFRW
WQPRHDGLDQNDWAIDNVLISGSADQRTVMLDTFSSAPVPQHERSPADAGPVGRIAFDMF
MEDKTSVNEHWLFHDDCTVERFCDSPDGVMLCGSHDGREVYAVTHDLTPTEGWIMQFKIS
VGCKVSEKIAQNQIHVQYSTDFGVSWNYLVPQCLPADPKCSGSVSQPSVFFPTKGWKRIT
YPLPESLVGNPVRFRFYQKYSDMQWAIDNFYLGPGCLDNCRGHGDCLREQCICDPGYSGP
NCYLTHTLKTFLKERFDSEEIKPDLWMSLEGGSTCTECGILAEDTALYFGGSTVRQAVTQ
DLDLRGAKFLQYWGRIGSENNMTSCHRPICRKEGVLLDYSTDGGITWTLLHEMDYQKYIS
VRHDYILLPEDALTNTTRLRWWQPFVISNGIVVSGVERAQWALDNILIGGAEINPSQLVD
TFDDEGTSHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKKDKTHNALSSRELIIQPGYMM
QFKIVVGCEATSCGDLHSVMLEYTKDARSDSWQLVQTQCLPSSSNSIGCSPFQFHEATIY
NSVNSSSWKRITIQLPDHVSSSATQFRWIQKGEETEKQSWAIDHVYIGEACPKLCSGHGY
CTTGAICICDESFQGDDCSVFSHDLPSYIKDNFESARVTEANWETIQGGVIGSGCGQLAP
YAHGDSLYFNGCQIRQAATKPLDLTRASKIMFVLQIGSMSQTDSCNSDLSGPHAVDKAVL
LQYSVNNGITWHVIAQHQPKDFTQAQRVSYNVPLEARMKGVLLRWWQPRHNGTGHDQWAL
DHVEVVLVSTRKQNYMMNFSRQHGLRHFYNRRRRSLRRYP
NT seq 10383 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcagtggctgggcccggcagactttcctcctagcgctgttgctgggggcgacg
ctgagggcgcgcgcggcggctggctattacccccgcttttcgcccttctttttcctgtgc
acccaccacggggagctggaaggggatggggagcagggcgaggtgctcatttccctgcat
attgcgggcaaccccacctactacgttccgggacaagaataccatgtgacaatttcaaca
agcaccttttttgacggcttgctggtgacaggactatacacatctacaagtgttcaggca
tcacagagcattggaggttccagtgctttcggatttgggatcatgtctgaccaccagttt
ggtaaccagtttatgtgcagtgtggtagcctctcacgtgagtcacctgcccacaaccaac
ctcagtttcatctggattgctccacctgcgggcacaggctgtgtgaatttcatggctaca
gcaacacaccggggccaggttattttcaaagatgctttagcccagcagttgtgtgaacaa
ggagctccaacagatgtcactgtgcacccacatctagctgaaatacatagtgacagcatt
atcctgagagatgactttgactcctaccaccaactgcaattaaatccaaatatatgggtt
gaatgtaacaactgtgagactggagaacagtgtggcgcgattatgcatggcaatgccgtc
accttctgtgaaccatatggcccacgagaactgattaccacaggccttaatacaacaaca
gcttctgtcctccaattttccattgggtcaggttcatgtcgctttagttattcagacccc
agcatcatcgtgttatatgccaagaataactctgcggactggattcagctagagaaaatt
agagccccttccaatgtcagcacaatcatccatatcctctaccttcctgaggacgccaaa
ggggagaatgtccaatttcagtggaagcaggaaaatcttcgtgtaggtgaagtgtatgaa
gcctgctgggccttagataacatcttgatcatcaattcagctcacagacaagtcgtttta
gaagatagtctcgacccagtggacacaggcaactggcttttcttcccaggagctacagtt
aagcatagctgtcagtcagatgggaactccatttatttccatggaaatgaaggcagcgag
ttcaattttgccaccaccagggatgtagatctttccacagaagatattcaagagcaatgg
tcagaagaatttgagagccagcctacaggatgggatgtcttgggagctgtcattggtaca
gaatgtggaacgatagaatcaggcttatcaatggtcttcctcaaagatggagagaggaaa
ttatgcactccatccatggacactaccggttatgggaacctgaggttttactttgtgatg
ggaggaatttgtgaccctggaaattctcatgaaaatgacataatcctgtatgcaaaaatt
gaaggaagaaaagagcatataacactggataccctttcctattcctcatataaggttccg
tctttggtttctgtggtcatcaatcctgaacttcagactcctgctaccaaattttgtctc
aggcaaaagaaccatcaaggacataataggaatgtctgggctgtagactttttccatgtc
ttgcctgttctcccttctacaatgtctcacatgatacagttttccatcaatctgggatgt
ggaacgcatcagcctggtaacagtgtcagcttggaattttctaccaaccatgggcgctcc
tggtccctccttcacactgaatgcttacctgagatctgtgctggaccccacctcccccac
agcactgtctactcctctgaaaactacagtgggtggaaccgaataacaattccccttcct
aacgcagcactaacccggaacaccaggattcgctggagacaaacaggaccaatccttgga
aacatgtgggcaattgataatgtttatattggcccgtcatgtctcaaattctgttctggc
agaggacagtgcactagacatggttgcaagtgtgaccctggattttctggcccagcttgt
gagatggcatcccagacattcccaatgtttatttctgaaagctttggcagttccaggctc
tcctcttaccataacttttactctatccgtggtgctgaagtcagctttggttgtggtgtc
ttggccagtggtaaggccctggttttcaacaaagatgggcggcgtcagctaattacatct
ttccttgacagctcacaatccaggtttctccagttcacactgagactggggagcaaatct
gttctgagcacgtgcagagcccctgatcagcctggtgaaggagttttgttgcattattct
tatgataatgggataacttggaaactcctggagcattattcatatctcagctatcatgag
cccagaataatctccgtagaactaccaggtgatgcaaagcagtttggaattcagttcaga
tggtggcaaccgtatcattcttcccagagagaagatgtatgggctattgatgagattatc
atgacatctgtgcttttcaacagcattagtcttgactttaccaatcttgtggaggtcact
cagtctctgggattctaccttggaaatgttcagccatactgtggccacgactggaccctt
tgttttacaggagattctaaacttgcctcaagtatgcgctatgtggaaacacaatcaatg
cagataggagcatcctatatgattcagttcagtttggtgatgggatgtggccagaaatac
accccacacatggacaaccaggtgaagctggagtactcaaccaaccacggccttacctgg
cacctcgtccaagaagaatgccttccaagtatgccaagttgtcaggaatttacatcagca
agtatttaccatgccagtgagtttacacagtggaggagagtcatagtgcttcttccccag
aaaacttggtccagtgctacccgtttccgctggagccagagctattacacagctcaagac
gagtgggctttggacagcatttacattgggcagcagtgccccaacatgtgcagtgggcat
ggctcatgcgatcatggcatatgcaggtgtgaccaggggtaccaaggcactgaatgccac
ccagaagctgcccttccgtccacaattatgtcagattttgagaaccagaatggctgggag
tctgactggcaagaagttattgggggagaaattgtaaaaccagaacaagggtgtggtgtc
atctcttctggatcatctctgtacttcagcaaggctgggaaaagacagctggtgagttgg
gacctggatacttcttgggtggactttgtccagttctacatccagataggcggagagagt
gcttcatgcaacaagcctgacagcagagaggagggcgtcctccttcagtacagcaacaat
gggggcatccagtggcacctgctagcagagatgtacttttcagacttcagcaaacccaga
tttgtctatctggagcttccagctgctgccaagaccccttgcaccaggttccgctggtgg
cagcccgtgttctcaggggaggactatgaccagtgggcagtcgatgacatcatcattctg
tccgagaagcagaagcagatcatcccagttatcaatccaactttacctcagaacttttat
gagaagccagcttttgattaccctatgaatcagatgagtgtgtggttgatgttggctaat
gaaggaatggttaaaaatgaaaccttctgtgctgccacaccatcagcaatgatatttgga
aaatcagatggagatcgatttgcagtaactcgagatttgaccctgaaacctggatatgtg
ctacagttcaagctaaacataggttgtgccaatcaattcagcagtactgctccagttctt
cttcagtactctcatgatgctggtatgtcctggtttctggtgaaagaaggctgttacccg
gcttctgcaggcaaaggatgcgaaggaaactccagagaactaagtgagcccaccatgtat
cacacaggggactttgaagaatggacaagaatcaccattgttattccaaggtctcttgca
tccagcaagaccagattccgatggatccaggagagcagctcacagaaaaacgtgcctcca
tttggtttagatggagtgtacatatccgagccttgtcccagttactgcagtggccatggg
gactgcatttcaggagtgtgtttctgtgacctgggatatactgctgcacaaggaacctgt
gtgtcaaatgtccccaatcacaatgagatgttcgataggtttgaggggaagctcagccct
ctgtggtacaagataacaggtgcccaggttggaactggctgtggaacacttaacgatggc
aaatctctctacttcaatggccctgggaaaagggaagcccggacggtccctctggacacc
aggaatatcagacttgttcaattttatatacaaattggaagcaaaacttcaggcattacc
tgcatcaaaccaagaactagaaatgaagggcttattgttcagtattcaaatgacaatggg
atactctggcatttgcttcgagagttggacttcatgtccttcctggaaccacagatcatt
tccattgacctgccacaggacgcgaagacacctgcaacggcatttcgatggtggcaaccg
caacatgggaagcattcagcccagtgggctttggatgatgttcttataggaatgaatgac
agctctcaaactggatttcaagacaaatttgatggctctatagatttgcaagccaactgg
tatcgaatccaaggaggtcaagttgatattgactgtctctctatggatactgctctgata
ttcactgaaaacataggaaaacctcgttatgctgagacctgggattttcatgtgtcagca
tctacctttttgcagtttgaaatgagcatgggctgtagcaagcccttcagcaactcccac
agtgtacagctccagtattctctgaacaatggcaaggactggcatcttgtcaccgaagag
tgtgttcctccaaccattggctgtctgcattacacggaaagttcaatttacacctcggaa
agattccagaattggaagcggatcactgtctaccttccactctccaccatttctcccagg
acccggttcagatggattcaggccaactacactgtgggggctgattcctgggcgattgat
aatgttgtactggcctcagggtgcccttggatgtgctcaggacgagggatttgtgatgct
ggacgctgtgtgtgtgaccggggctttggtggaccctattgtgttcctgttgttcctctg
ccctcgattcttaaagacgatttcaatgggaatttacatcctgacctttggcctgaagtg
tatggtgcagagagggggaatctgaatggtgaaaccatcaaatctggaacatctctaatt
tttaaaggggaaggactaaggatgcttatttcaagagatctagattgtacaaatacaatg
tatgtccagttttcacttagatttatagcaaaaagtaccccagagagatctcactctatt
ctgttacaattctccatcagtggaggaatcacttggcacctgatggatgaattttacttt
cctcaaacaacgaatatacttttcatcaatgttcccttgccatacactgcccaaaccaat
gctacaagattcagactctggcaaccttataataacggtaagaaagaagaaatctggatt
gttgatgacttcattatcgatggaaataatgtaaacaaccctgtgatgctcttggataca
tttgattttgggcccagagaagacaattggtttttctatcctggtggtaacatcggtctt
tattgtccatattcttcaaagggggcacctgaagaagattcagctatggtgtttgtttca
aatgaagttggtgagcattccattaccacccgtgacctaaatgtgaatgagaacaccatc
atacaatttgagatcaacgttggctgttcgactgatagctcatccgcggatccagtgaga
ctggaattttcaagggacttcggggcgacctggcaccttctgctgcccctctgctaccac
agcagcagccacgtcagctctttatgctccaccgagcaccaccccagcagcacctactac
gcaggaaccatgcagggctggaggagggaggtcgtgcactttgggaagctgcacctttgt
ggatctgtccgtttcagatggtaccagggattttaccctgccggctctcagccagtgaca
tgggccattgataatgtctacatcggtccccagtgtgaggagatgtgtaatggacagggg
agctgtatcaatggaaccaaatgtatatgtgaccctggctactcaggtccaacctgtaaa
ataagcaccaaaaatcctgattttctcaaagatgatttcgaaggtcagctagaatctgat
agattcttattaatgagtggtgggaaaccatctcgaaagtgtggaatcctttctagtgga
aacaacctctttttcaatgaagatggcttgcgcatgttgatgacacgagacctggattta
tcacatgctagatttgtgcagttcttcatgagactgggatgtggtaaaggcgttcctgac
cccaggagtcaacccgtgctcctacagtattctctcaacggtggcctctcgtggagtctt
cttcaggagttccttttcagcaattccagcaatgtgggcaggtacattgccctggagata
cccttgaaagcccgttctggttctactcgccttcgctggtggcaaccgtctgagaatggg
cacttctacagcccctgggttatcgatcagattcttattggaggaaatatttctggtaat
acggtcttggaagatgatttcacaacccttgatagtaggaaatggctgcttcacccagga
ggcaccaagatgcccgtgtgtggctctactggtgatgccctggtcttcattgaaaaggcc
agcacccgttacgtggtcagcacagacgttgccgtgaatgaggattccttcctacagata
gacttcgctgcctcctgctcagtcacagactcttgttatgcgattgaattggaatactca
gtagatcttggattgtcatggcacccattggtaagggactgtctgcctaccaatgtggaa
tgcagtcgctatcatctgcaacggatcctggtgtcagacactttcaacaagtggactaga
atcactctgcctctccctccttataccaggtcccaagccactcgtttccgttggcatcaa
ccagctccttttgacaagcagcagacatgggcaatagataatgtctatatcggggatggc
tgcatagacatgtgcagtggccatgggagatgcatccagggaaactgcgtctgtgatgaa
cagtggggtggcctgtactgtgatgaccccgagacctctcttccaacccaactcaaagac
aacttcaatcgagctccatccagtcagaactggctgactgtgaacggagggaaattgagt
acagtgtgtggagccgtggcgtcgggaatggctctccatttcagtgggggttgtagtcga
ttattagtcactgtggatctaaacctcactaatgctgagttcatccaattttacttcatg
tatgggtgcctgattacaccaaacaaccgtaaccaaggtgttctcttggaatattctgtc
aatggaggcattacctggaacctgctcatggagattttctatgaccagtacagtaagccc
ggatttgtgaatatccttctccctcctgatgctaaagagattgccactcgcttccgctgg
tggcagccaagacatgacggcctggatcagaacgactgggccattgacaatgtcctcatc
tcaggctctgctgaccaaaggaccgttatgctggacaccttcagcagcgccccagtaccc
cagcatgagcgctcccctgcagatgccggccctgtcgggaggatcgcctttgacatgttt
atggaagacaaaacttcagtgaatgagcactggctattccatgatgattgtacagtagaa
agattctgtgactcccctgatggtgtgatgctctgtggcagtcatgatggacgggaggtg
tatgcagtgacccatgacctgactcccactgaaggctggattatgcaattcaagatctca
gttggatgtaaggtgtctgaaaaaattgcccagaatcaaattcatgtgcagtattctact
gacttcggtgtgagttggaattatctggtccctcagtgcttgcctgctgacccaaaatgc
tctggaagtgtttctcagccatctgtattctttccaactaaagggtggaaaaggatcacc
tacccacttcctgaaagcttagtgggaaatccggtaaggtttaggttctatcagaagtac
tcagacatgcagtgggcaatcgataatttctacctgggccctggatgcttggacaactgc
aggggccatggagattgcttaagggaacagtgcatctgtgatccgggatactcagggcca
aactgctacttgacccacactctgaagactttcctgaaggaacgctttgacagtgaagaa
atcaaacctgacttatggatgtccttagaaggtggaagtacttgcactgagtgtggaatt
cttgccgaggacactgcactctattttgggggatccactgtgagacaagcggttacacaa
gatttggatcttcgaggtgcaaagttcctgcaatactgggggcgcatcggtagtgagaac
aacatgacctcttgccatcgtcccatctgccggaaggaaggcgtgctgttggactactct
accgatggaggaattacctggactttgctccatgagatggattaccagaaatacatttct
gttagacacgactacatacttcttcctgaagatgccctcaccaacacaactcgacttcgc
tggtggcagccttttgtgatcagcaatggaattgtggtctctggggtggagcgtgctcag
tgggcactggacaacattttgattggtggagcagaaatcaatcccagccaattggtggac
acttttgatgatgaaggcacttcccatgaagaaaactggagtttttaccctaatgctgta
aggacagcaggattttgtggcaatccatcctttcacctctattggccaaataaaaagaag
gacaagactcacaatgctctctcctcccgagaactcattatacagccaggatacatgatg
cagtttaaaattgtggtgggttgtgaagccacttcttgtggtgaccttcattccgtaatg
ctggaatacactaaggatgcaagatcggattcctggcagctcgtacagacccagtgcctt
ccttcctcttctaacagcattggctgctcccctttccagttccatgaagccaccatctac
aactctgtcaacagctcaagctggaaaagaatcaccatccagctgcctgaccatgtctcc
tctagtgcaacacagttccgctggatccagaagggagaagaaactgagaagcaaagctgg
gcaattgaccacgtgtacattggagaggcttgccccaagctctgcagcgggcacggatac
tgcacgaccggtgccatctgcatctgcgacgagagcttccaaggtgatgactgctctgtt
ttcagtcacgaccttcccagttatattaaagataattttgagtccgcaagagtcaccgag
gcaaactgggagaccattcaaggtggagtcataggaagtggctgtgggcagctggccccc
tacgcccatggagactcactgtactttaatggctgtcagatcaggcaagcagctaccaag
cctctggatctcactcgagcaagcaaaatcatgtttgttttgcaaattgggagcatgtcg
cagacggacagctgcaacagtgacctgagtggcccccacgctgtggacaaggcagtgctg
ctgcaatacagcgtcaacaacgggatcacctggcatgtcatcgcccagcaccagccaaag
gacttcacacaagctcagagagtgtcttacaatgtccccctggaggcacggatgaaagga
gtcttactgcgctggtggcaaccacgccacaatggaacaggtcatgatcaatgggctttg
gaccatgtggaggtcgtcctagtaagcactcgcaaacaaaattacatgatgaatttttca
cgacaacatgggctcagacatttctacaacagaagacgaaggtcacttaggcgataccca
tga

DBGET integrated database retrieval system