KEGG   Homo sapiens (human): 5805Help
Entry
5805              CDS       T01001                                 

Gene name
PTS, PTPS
Definition
6-pyruvoyltetrahydropterin synthase (EC:4.2.3.12)
Orthology
K01737  
6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50]
Organism
hsa  Homo sapiens (human)
Pathway
Folate biosynthesis
Metabolic pathways
Disease
H00167  
Phenylketonuria (PKU)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    5805 (PTS)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.50  6-carboxytetrahydropterin synthase
     5805 (PTS)
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     5805 (PTS)
Transfer RNA biogenesis [BR:hsa03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    5805 (PTS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
11q22.3
AA seq 145 aa AA seqDB search
MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVH
GEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQK
VLPVGVLYKVKVYETDNNIVVYKGE
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggaaggtggtggccgtcgctgccaggcacaagtgtcccgccgcatctccttc
agcgcgagccaccgattgtacagtaaatttctaagtgatgaagaaaacttgaaactgttt
gggaaatgcaacaatccaaatggccatgggcacaattataaagttgtggtgacagtacat
ggagagattgaccctgctacgggaatggttatgaatctggctgatctcaaaaaatatatg
gaggaggcgattatgcagccccttgatcataagaatctggatatggatgtgccatacttt
gcagatgtggtgagcacgactgaaaatgtagctgtttatatctgggacaacctccagaaa
gttcttcctgtaggagttctttataaagtaaaagtatacgaaactgacaataatattgtg
gtttataaaggagaatag

DBGET integrated database retrieval system