KEGG   Homo sapiens (human): 5896Help
Entry
5896              CDS       T01001                                 

Gene name
RAG1, RAG-1, RNF74
Definition
recombination activating gene 1
Orthology
K10628  
V(D)J recombination-activating protein 1 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Primary immunodeficiency
Disease
H00092  
T-B-Severe combined immunodeficiencies (SCIDs)
H00093  
Combined immunodeficiencies (CIDs)
H01244  
T+B+Severe combined immunodeficiencies (SCIDs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    5896 (RAG1)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    5896 (RAG1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     5896 (RAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
11p13
AA seq 1043 aa AA seqDB search
MAASFPPTLGLSSAPDEIQHPHIKFSEWKFKLFRVRSFEKTPEEAQKEKKDSFEGKPSLE
QSPAVLDKADGQKPVPTQPLLKAHPKFSKKFHDNEKARGKAIHQANLRHLCRICGNSFRA
DEHNRRYPVHGPVDGKTLGLLRKKEKRATSWPDLIAKVFRIDVKADVDSIHPTEFCHNCW
SIMHRKFSSAPCEVYFPRNVTMEWHPHTPSCDICNTARRGLKRKSLQPNLQLSKKLKTVL
DQARQARQRKRRAQARISSKDVMKKIANCSKIHLSTKLLAVDFPEHFVKSISCQICEHIL
ADPVETNCKHVFCRVCILRCLKVMGSYCPSCRYPCFPTDLESPVKSFLSVLNSLMVKCPA
KECNEEVSLEKYNHHISSHKESKEIFVHINKGGRPRQHLLSLTRRAQKHRLRELKLQVKA
FADKEEGGDVKSVCMTLFLLALRARNEHRQADELEAIMQGKGSGLQPAVCLAIRVNTFLS
CSQYHKMYRTVKAITGRQIFQPLHALRNAEKVLLPGYHHFEWQPPLKNVSSSTDVGIIDG
LSGLSSSVDDYPVDTIAKRFRYDSALVSALMDMEEDILEGMRSQDLDDYLNGPFTVVVKE
SCDGMGDVSEKHGSGPVVPEKAVRFSFTIMKITIAHSSQNVKVFEEAKPNSELCCKPLCL
MLADESDHETLTAILSPLIAEREAMKSSELMLELGGILRTFKFIFRGTGYDEKLVREVEG
LEASGSVYICTLCDATRLEASQNLVFHSITRSHAENLERYEVWRSNPYHESVEELRDRVK
GVSAKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKNPNASKEERKRWQATLDKHL
RKKMNLKPIMRMNGNFARKLMTKETVDAVCELIPSEERHEALRELMDLYLKMKPVWRSSC
PAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWA
SEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYTSKYLQKFMNAHNALKTSGFTMN
PQASLGDPLGIEDSLESQDSMEF
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctctttcccacccaccttgggactcagttctgccccagatgaaattcagcac
ccacatattaaattttcagaatggaaatttaagctgttccgggtgagatcctttgaaaag
acacctgaagaagctcaaaaggaaaagaaggattcctttgaggggaaaccctctctggag
caatctccagcagtcctggacaaggctgatggtcagaagccagtcccaactcagccattg
ttaaaagcccaccctaagttttcaaagaaatttcacgacaacgagaaagcaagaggcaaa
gcgatccatcaagccaaccttcgacatctctgccgcatctgtgggaattcttttagagct
gatgagcacaacaggagatatccagtccatggtcctgtggatggtaaaaccctaggcctt
ttacgaaagaaggaaaagagagctacttcctggccggacctcattgccaaggttttccgg
atcgatgtgaaggcagatgttgactcgatccaccccactgagttctgccataactgctgg
agcatcatgcacaggaagtttagcagtgccccatgtgaggtttacttcccgaggaacgtg
accatggagtggcacccccacacaccatcctgtgacatctgcaacactgcccgtcgggga
ctcaagaggaagagtcttcagccaaacttgcagctcagcaaaaaactcaaaactgtgctt
gaccaagcaagacaagcccgtcagcgcaagagaagagctcaggcaaggatcagcagcaag
gatgtcatgaagaagatcgccaactgcagtaagatacatcttagtaccaagctccttgca
gtggacttcccagagcactttgtgaaatccatctcctgccagatctgtgaacacattctg
gctgaccctgtggagaccaactgtaagcatgtcttttgccgggtctgcattctcagatgc
ctcaaagtcatgggcagctattgtccctcttgccgatatccatgcttccctactgacctg
gagagtccagtgaagtcctttctgagcgtcttgaattccctgatggtgaaatgtccagca
aaagagtgcaatgaggaggtcagtttggaaaaatataatcaccacatctcaagtcacaag
gaatcaaaagagatttttgtgcacattaataaagggggccggccccgccaacatcttctg
tcgctgactcggagagctcagaagcaccggctgagggagctcaagctgcaagtcaaagcc
tttgctgacaaagaagaaggtggagatgtgaagtccgtgtgcatgaccttgttcctgctg
gctctgagggcgaggaatgagcacaggcaagctgatgagctggaggccatcatgcaggga
aagggctctggcctgcagccagctgtttgcttggccatccgtgtcaacaccttcctcagc
tgcagtcagtaccacaagatgtacaggactgtgaaagccatcacagggagacagattttt
cagcctttgcatgcccttcggaatgctgagaaggtacttctgccaggctaccaccacttt
gagtggcagccacctctgaagaatgtgtcttccagcactgatgttggcattattgatggg
ctgtctggactatcatcctctgtggatgattacccagtggacaccattgcaaagaggttc
cgctatgattcagctttggtgtctgctttgatggacatggaagaagacatcttggaaggc
atgagatcccaagaccttgatgattacctgaatggccccttcactgtggtggtgaaggag
tcttgtgatggaatgggagacgtgagtgagaagcatgggagtgggcctgtagttccagaa
aaggcagtccgtttttcattcacaatcatgaaaattactattgcccacagctctcagaat
gtgaaagtatttgaagaagccaaacctaactctgaactgtgttgcaagccattgtgcctt
atgctggcagatgagtctgaccacgagacgctgactgccatcctgagtcctctcattgct
gagagggaggccatgaagagcagtgaattaatgcttgagctgggaggcattctccggact
ttcaagttcatcttcaggggcaccggctatgatgaaaaacttgtgcgggaagtggaaggc
ctcgaggcttctggctcagtctacatttgtactctttgtgatgccacccgtctggaagcc
tctcaaaatcttgtcttccactctataaccagaagccatgctgagaacctggaacgttat
gaggtctggcgttccaacccttaccatgagtctgtggaagaactgcgggatcgggtgaaa
ggggtctcagctaaacctttcattgagacagtcccttccatagatgcactccactgtgac
attggcaatgcagctgagttctacaagatcttccagctagagataggggaagtgtataag
aatcccaatgcttccaaagaggaaaggaaaaggtggcaggccacactggacaagcatctc
cggaagaagatgaacctcaaaccaatcatgaggatgaatggcaactttgccaggaagctc
atgaccaaagagactgtggatgcagtttgtgagttaattccttccgaggagaggcacgag
gctctgagggagctgatggatctttacctgaagatgaaaccagtatggcgatcatcatgc
cctgctaaagagtgcccagaatccctctgccagtacagtttcaattcacagcgttttgct
gagctcctttctacgaagttcaagtataggtatgagggaaaaatcaccaattattttcac
aaaaccctggcccatgttcctgaaattattgagagggatggctccattggggcatgggca
agtgagggaaatgagtctggtaacaaactgtttaggcgcttccggaaaatgaatgccagg
cagtccaaatgctatgagatggaagatgtcctgaaacaccactggttgtacacctccaaa
tacctccagaagtttatgaatgctcataatgcattaaaaacctctgggtttaccatgaac
cctcaggcaagcttaggggacccattaggcatagaggactctctggaaagccaagattca
atggaattttaa

DBGET integrated database retrieval system