KEGG   Homo sapiens (human): 5914Help
Entry
5914              CDS       T01001                                 

Gene name
RARA, NR1B1, RAR
Definition
retinoic acid receptor, alpha
Orthology
K08527  
retinoic acid receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia
Disease
H00003  
Acute myeloid leukemia (AML)
H00516  
Isolated orofacial clefts
Drug target
Retinol (vit A): 
Tazarotene: 
Etretinate: 
Acitretin: 
Tretinoin: 
Adapalene: 
Isotretinoin: 
Alitretinoin: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5914 (RARA)
   05202 Transcriptional misregulation in cancers
    5914 (RARA)
   05221 Acute myeloid leukemia
    5914 (RARA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5914 (RARA)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   5914 (RARA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
17q21
AA seq 462 aa AA seqDB search
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaacagcagctcctgcccgacacctgggggcgggcacctcaatgggtacccg
gtgcctccctacgccttcttcttcccccctatgctgggtggactctccccgccaggcgct
ctgaccactctccagcaccagcttccagttagtggatatagcacaccatccccagccacc
attgagacccagagcagcagttctgaagagatagtgcccagccctccctcgccaccccct
ctaccccgcatctacaagccttgctttgtctgtcaggacaagtcctcaggctaccactat
ggggtcagcgcctgtgagggctgcaagggcttcttccgccgcagcatccagaagaacatg
gtgtacacgtgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgctgc
cagtactgccgactgcagaagtgctttgaagtgggcatgtccaaggagtctgtgagaaac
gaccgaaacaagaagaagaaggaggtgcccaagcccgagtgctctgagagctacacgctg
acgccggaggtgggggagctcattgagaaggtgcgcaaagcgcaccaggaaaccttccct
gccctctgccagctgggcaaatacactacgaacaacagctcagaacaacgtgtctctctg
gacattgacctctgggacaagttcagtgaactctccaccaagtgcatcattaagactgtg
gagttcgccaagcagctgcccggcttcaccaccctcaccatcgccgaccagatcaccctc
ctcaaggctgcctgcctggacatcctgatcctgcggatctgcacgcggtacacgcccgag
caggacaccatgaccttctcggacgggctgaccctgaaccggacccagatgcacaacgct
ggcttcggccccctcaccgacctggtctttgccttcgccaaccagctgctgcccctggag
atggatgatgcggagacggggctgctcagcgccatctgcctcatctgcggagaccgccag
gacctggagcagccggaccgggtggacatgctgcaggagccgctgctggaggcgctaaag
gtctacgtgcggaagcggaggcccagccgcccccacatgttccccaagatgctaatgaag
attactgacctgcgaagcatcagcgccaagggggctgagcgggtgatcacgctgaagatg
gagatcccgggctccatgccgcctctcatccaggaaatgttggagaactcagagggcctg
gacactctgagcggacagccggggggtggggggcgggacgggggtggcctggcccccccg
ccaggcagctgtagccccagcctcagccccagctccaacagaagcagcccggccacccac
tccccgtga

DBGET integrated database retrieval system