KEGG   Homo sapiens (human): 5921Help
Entry
5921              CDS       T01001                                 

Gene name
RASA1, CM-AVM, CMAVM, GAP, PKWS, RASA, RASGAP, p120GAP, p120RASGAP
Definition
RAS p21 protein activator (GTPase activating protein) 1
Orthology
K04352  
Ras GTPase-activating protein 1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Axon guidance
Disease
H00532  
RASA1-related disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5921 (RASA1)
   04010 MAPK signaling pathway
    5921 (RASA1)
 Organismal Systems
  Development
   04360 Axon guidance
    5921 (RASA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
5q13.3
AA seq 1047 aa AA seqDB search
MMAAEAGSEEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPVAAAPYPGLVETGVAGT
LGGGAALGSEFLGAGSVAGALGGAGLTGGGTAAGVAGAAAGVAGAAVAGPSGDMALTKLP
TSLLAETLGPGGGFPPLPPPPYLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQ
WYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYY
IGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEIS
FLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKISKQE
AYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIG
DIIDHYRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGY
LLKKGKGKRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNC
FQIVVQHFSEEHYIFYFAGETPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHI
EEAHKLPVKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVFDDLPPDINRFEITLSN
KTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPE
EEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISM
EDEATTLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNED
VNTNLTHLLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFV
FLRLICPAILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFI
KSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQ
HVLKKLLAITELLQQKQNQYTKTNDVR
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggccgaggccggcagtgaggagggcggcccggtaacagccggagctggagga
ggcggcgcggcagcgggctccagtgcctatcccgcagtgtgtcgggtgaagatacccgcg
gccctgcctgtggcagccgccccctatcctgggctggtggagaccggagtggctggaact
ctgggtggcggagccgctttggggtcagagttcctaggagccgggtctgtggcaggggca
ctggggggagctggactgacagggggaggtactgctgctggcgtagctggtgctgctgct
ggcgtggccggtgctgctgttgctggacctagtggagacatggctctcaccaaactgccc
acttcgttgcttgctgagactctcgggccaggcggcggttttccccctctgccccctccc
ccttacctgccccctttgggggcgggcctcgggacagtggacgaaggtgactctctggat
ggaccagaatacgaggaggaagaggtggccataccgttgaccgctcctccaactaaccag
tggtatcacggaaaacttgacagaacgatagcagaagaacgcctcaggcaggcagggaag
tctggcagttatcttataagagagagtgatcggaggccagggtcctttgtactttcattt
cttagccagatgaatgttgtcaaccattttaggattattgctatgtgtggagattactac
attggtggaagacgtttttcttcactgtcagacctaataggttattacagtcatgtttct
tgtttgcttaaaggagaaaaattactttacccagttgcaccaccagagccagtagaagat
agaaggcgtgtacgagctattctaccttacacaaaagtaccagacactgatgaaataagt
ttcttaaaaggagatatgttcattgttcataatgaattagaagatggatggatgtgggtt
acaaatttaagaacagatgaacaaggccttattgttgaagacctagtagaagaggtgggc
cgggaagaagatccacatgaaggaaaaatatggttccatgggaagatttccaaacaggaa
gcttataatttactaatgacagttggtcaagtctgcagttttcttgtgaggccctcagat
aatactcctggcgattattcactttatttccggaccaatgaaaatattcagcgatttaaa
atatgtccaacgccaaacaatcagtttatgatgggaggccggtattataacagcattggg
gacatcatagatcactatcgaaaagaacagattgttgaaggatattatcttaaggaacct
gtaccaatgcaggatcaagaacaagtactcaatgacacagtggatggcaaggaaatctat
aataccatccgtcgtaaaacaaaggatgccttttataaaaacattgttaagaaaggttat
cttctgaaaaagggcaaaggaaaacgttggaaaaatttatattttatcttagagggtagt
gatgcccaacttatttattttgaaagcgaaaaacgagctaccaaaccaaaaggattaata
gatctcagtgtatgttctgtctatgtcgttcatgatagtctctttggcaggccaaactgt
tttcagatagtagttcagcactttagtgaagaacattacatcttttactttgcaggagaa
actccagaacaagcagaggattggatgaaaggtctgcaggcattttgcaatttacggaaa
agtagtccagggacatccaataaacgccttcgtcaggtcagcagccttgttttacatatt
gaagaagcccataaactcccagtaaaacattttactaatccatattgtaacatctacctg
aatagtgtccaagtagcaaaaactcatgcaagggaagggcaaaacccagtatggtcagaa
gagtttgtctttgatgatcttcctcctgacatcaatagatttgaaataactcttagtaat
aaaacaaagaaaagcaaagatcctgatatcttatttatgcgctgccagttgagccgatta
cagaaagggcatgccacagatgaatggtttctgctcagctcccatataccattaaaaggt
attgaaccagggtccctgcgtgttcgagcacgatactctatggaaaaaatcatgccagaa
gaagagtacagtgaatttaaagagcttatactgcaaaaggaacttcatgtagtctatgct
ttatcacatgtatgtggacaagaccgaacactactggccagcatcctactgaggattttt
cttcacgaaaagcttgaatcgttgttgttatgcacactaaatgacagagaaataagcatg
gaagatgaagccactaccctatttcgagccacaacacttgcaagcaccttgatggagcag
tatatgaaagccactgctacacagtttgttcatcatgctttgaaagactctattttaaag
ataatggaaagcaagcagtcttgtgagttaagtccatcaaagttagaaaaaaatgaagat
gtgaacactaatttaacacacctattgaacatactttcagagcttgtggagaaaatattc
atggcttcagaaatacttccaccgacattgagatatatttatgggtgtttacagaaatct
gttcagcataagtggcctacaaataccaccatgagaacaagagttgttagtggttttgtt
tttcttcgactcatctgtcctgccatcctgaatccacggatgttcaatatcatctcagat
tctccatctcctattgctgcaagaacactgatattagtggctaaatctgtgcagaactta
gcaaatcttgtggaatttggagctaaggagccctacatggaaggtgtcaatccattcatc
aaaagcaacaaacatcgtatgatcatgtttttagatgaacttgggaatgtacctgaactt
ccggacactacagagcattctagaacggacctgtcccgtgatttagcagcattgcatgag
atttgcgtggctcattcagatgaacttcgaacgctcagtaatgagcgtggtgcacagcag
cacgtattgaaaaagcttctggctataacagaactgcttcaacaaaaacaaaaccagtat
acaaaaaccaatgatgtcaggtag

DBGET integrated database retrieval system