KEGG   Homo sapiens (human): 613Help
Entry
613               CDS       T01001                                 

Gene name
BCR, ALL, BCR1, CML, D22S11, D22S662, PHL
Definition
breakpoint cluster region (EC:2.7.11.1)
Orthology
K08878  
breakpoint cluster region protein [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Chronic myeloid leukemia
Disease
H00001  
Acute lymphoblastic leukemia (ALL) (precursor B lymphoblastic leukemia)
H00004  
Chronic myeloid leukemia (CML)
Class
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hsa05220]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
22q11.23
AA seq 1271 aa AA seqDB search
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQAPDGASEPRASASRPQPAPADGADPPPAEEPEARPDGE
GSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSC
GVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQSIYVGGMMEGEGKGPLLRSQ
STSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEG
AFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSRDALVSG
ALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGV
AMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDL
LKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVE
GARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELEAVPNIPLVP
DEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRN
GKSYTFLISSDYERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTIN
KEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNE
EFEIELEGSQTLRILCYEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVI
AMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIER
RGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLF
TDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSL
HNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDS
KRQSILFSTEV
NT seq 3816 nt NT seq  +upstreamnt  +downstreamnt
atggtggacccggtgggcttcgcggaggcgtggaaggcgcagttcccggactcagagccc
ccgcgcatggagctgcgctcagtgggcgacatcgagcaggagctggagcgctgcaaggcc
tccattcggcgcctggagcaggaggtgaaccaggagcgcttccgcatgatctacctgcag
acgttgctggccaaggaaaagaagagctatgaccggcagcgatggggcttccggcgcgcg
gcgcaggcccccgacggcgcctccgagccccgagcgtccgcgtcgcgcccgcagccagcg
cccgccgacggagccgacccgccgcccgccgaggagcccgaggcccggcccgacggcgag
ggttctccgggtaaggccaggcccgggaccgcccgcaggcccggggcagccgcgtcgggg
gaacgggacgaccggggaccccccgccagcgtggcggcgctcaggtccaacttcgagcgg
atccgcaagggccatggccagcccggggcggacgccgagaagcccttctacgtgaacgtc
gagtttcaccacgagcgcggcctggtgaaggtcaacgacaaagaggtgtcggaccgcatc
agctccctgggcagccaggccatgcagatggagcgcaaaaagtcccagcacggcgcgggc
tcgagcgtgggggatgcatccaggcccccttaccggggacgctcctcggagagcagctgc
ggcgtcgacggcgactacgaggacgccgagttgaacccccgcttcctgaaggacaacctg
atcgacgccaatggcggtagcaggcccccttggccgcccctggagtaccagccctaccag
agcatctacgtcgggggcatgatggaaggggagggcaagggcccgctcctgcgcagccag
agcacctctgagcaggagaagcgccttacctggccccgcaggtcctactccccccggagt
tttgaggattgcggaggcggctataccccggactgcagctccaatgagaacctcacctcc
agcgaggaggacttctcctctggccagtccagccgcgtgtccccaagccccaccacctac
cgcatgttccgggacaaaagccgctctccctcgcagaactcgcaacagtccttcgacagc
agcagtccccccacgccgcagtgccataagcggcaccggcactgcccggttgtcgtgtcc
gaggccaccatcgtgggcgtccgcaagaccgggcagatctggcccaacgatggcgagggc
gccttccatggagacgcagatggctcgttcggaacaccacctggatacggctgcgctgca
gaccgggcagaggagcagcgccggcaccaagatgggctgccctacattgatgactcgccc
tcctcatcgccccacctcagcagcaagggcaggggcagccgggatgcgctggtctcggga
gccctggagtccactaaagcgagtgagctggacttggaaaagggcttggagatgagaaaa
tgggtcctgtcgggaatcctggctagcgaggagacttacctgagccacctggaggcactg
ctgctgcccatgaagcctttgaaagccgctgccaccacctctcagccggtgctgacgagt
cagcagatcgagaccatcttcttcaaagtgcctgagctctacgagatccacaaggagttc
tatgatgggctcttcccccgcgtgcagcagtggagccaccagcagcgggtgggcgacctc
ttccagaagctggccagccagctgggtgtgtaccgggccttcgtggacaactacggagtt
gccatggaaatggctgagaagtgctgtcaggccaatgctcagtttgcagaaatctccgag
aacctgagagccagaagcaacaaagatgccaaggatccaacgaccaagaactctctggaa
actctgctctacaagcctgtggaccgtgtgacgaggagcacgctggtcctccatgacttg
ctgaagcacactcctgccagccaccctgaccaccccttgctgcaggacgccctccgcatc
tcacagaacttcctgtccagcatcaatgaggagatcacaccccgacggcagtccatgacg
gtgaagaagggagagcaccggcagctgctgaaggacagcttcatggtggagctggtggag
ggggcccgcaagctgcgccacgtcttcctgttcaccgacctgcttctctgcaccaagctc
aagaagcagagcggaggcaaaacgcagcagtatgactgcaaatggtacattccgctcacg
gatctcagcttccagatggtggatgaactggaggcagtgcccaacatccccctggtgccc
gatgaggagctggacgctttgaagatcaagatctcccagatcaagaatgacatccagaga
gagaagagggcgaacaagggcagcaaggctacggagaggctgaagaagaagctgtcggag
caggagtcactgctgctgcttatgtctcccagcatggccttcagggtgcacagccgcaac
ggcaagagttacacgttcctgatctcctctgactatgagcgtgcagagtggagggagaac
atccgggagcagcagaagaagtgtttcagaagcttctccctgacatccgtggagctgcag
atgctgaccaactcgtgtgtgaaactccagactgtccacagcattccgctgaccatcaat
aaggaagatgatgagtctccggggctctatgggtttctgaatgtcatcgtccactcagcc
actggatttaagcagagttcaaatctgtactgcaccctggaggtggattcctttgggtat
tttgtgaataaagcaaagacgcgcgtctacagggacacagctgagccaaactggaacgag
gaatttgagatagagctggagggctcccagaccctgaggatactgtgctatgaaaagtgt
tacaacaagacgaagatccccaaggaggacggcgagagcacggacagactcatggggaag
ggccaggtccagctggacccgcaggccctgcaggacagagactggcagcgcaccgtcatc
gccatgaatgggatcgaagtaaagctctcggtcaagttcaacagcagggagttcagcttg
aagaggatgccgtcccgaaaacagacaggggtcttcggagtcaagattgctgtggtcacc
aagagagagaggtccaaggtgccctacatcgtgcgccagtgcgtggaggagatcgagcgc
cgaggcatggaggaggtgggcatctaccgcgtgtccggtgtggccacggacatccaggca
ctgaaggcagccttcgacgtcaataacaaggacgtgtcggtgatgatgagcgagatggac
gtgaacgccatcgcaggcacgctgaagctgtacttccgtgagctgcccgagcccctcttc
actgacgagttctaccccaacttcgcagagggcatcgctctttcagacccggttgcaaag
gagagctgcatgctcaacctgctgctgtccctgccggaggccaacctgctcaccttcctt
ttccttctggaccacctgaaaagggtggcagagaaggaggcagtcaataagatgtccctg
cacaacctcgccacggtctttggccccacgctgctccggccctccgagaaggagagcaag
ctccctgccaaccccagccagcctatcaccatgactgacagctggtccttggaggtcatg
tcccaggtccaggtgctgctgtacttcctgcagctggaggccatccctgccccggacagc
aagagacagagcatcctgttctccaccgaagtctaa

DBGET integrated database retrieval system