KEGG   Homo sapiens (human): 6262Help
Entry
6262              CDS       T01001                                 

Gene name
RYR2, ARVC2, ARVD2, RYR-2, RyR, VTSIP
Definition
ryanodine receptor 2 (cardiac)
Orthology
K04962  
ryanodine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Circadian entrainment
Insulin secretion
Oxytocin signaling pathway
Pancreatic secretion
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Disease
H00293  
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
H01019  
Catecholaminergic polymorphic ventricular tachycardia
Drug target
Procaine: 
Dantrolene: 
Suramin sodium: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    6262 (RYR2)
   04024 cAMP signaling pathway
    6262 (RYR2)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    6262 (RYR2)
   04921 Oxytocin signaling pathway
    6262 (RYR2)
  Circulatory system
   04260 Cardiac muscle contraction
    6262 (RYR2)
   04261 Adrenergic signaling in cardiomyocytes
    6262 (RYR2)
  Digestive system
   04972 Pancreatic secretion
    6262 (RYR2)
  Environmental adaptation
   04713 Circadian entrainment
    6262 (RYR2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    6262 (RYR2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    6262 (RYR2)
   05414 Dilated cardiomyopathy (DCM)
    6262 (RYR2)
Ion channels [BR:hsa04040]
 Ryanodine and IP3 receptors
  Ryanodine receptor (RYR)
   6262 (RYR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
1q43
AA seq 4967 aa AA seqDB search
MADGGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPP
DLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLLYGHAIL
LRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDD
LILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGH
MDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHV
TTGKYLSLMEDKNLLLMDKEKADVKSTAFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSV
CYIQHVDTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMDDGISLSRSQHEESRTARVIR
STVFLFNRFIRGLDALSKKAKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLR
ALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAAL
IRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISL
LDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIF
LGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGD
DLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFE
NFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREY
KQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIEL
GWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEDK
VKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGI
QQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSG
TGERFRIFRAEKTYAVKAGRWYFEFETVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGF
KAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDG
FIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQ
VPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSNTDIMFYRLSMPIECAEVFSKTVAG
GLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEK
PSRLKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYDFLMQTSTYYYSVRIFPGQEPAN
VWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGR
NNNGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRI
KNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQ
CLDPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHV
DEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEYIVPMTEETKSITLFP
DENKKHGLPGIGLSTSLRPRMQFSSPSFVSISNECYQYSPEFPLDILKSKTIQMLTEAVK
EGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAATPEEE
SDTLEKELSVDDAKLQGAGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRH
RIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFK
DDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDLTIRGRLLSLVEKVTYLK
KKQAEKPVESDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVR
ALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPN
LMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSY
LLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQML
VSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGG
NGLLAAMEEAIKIAEDPSRDGPSPNSGSSKTLDTEEEEDDTIHMGNAIMTFYSALIDLLG
RCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNVVEPDMSAGF
CPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYL
CTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQL
RPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHL
SRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGN
FNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPY
KLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHG
YSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPLLVPYDTLTAK
EKAKDREKAQDILKFLQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYI
LEFDGGSRGKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKE
KEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKSALRAF
LDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGED
LILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNI
YSIYNTKSSRERAALSLPTNVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILP
MLCSYMSRWWEHGPENNPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLA
VFSQPIINKVKPQLLKTHFLPLMEKLKKKAATVVSEEDHLKAEARGDMSEAELLILDEFT
TLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFV
VQNEINNMSFLITDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNI
CAPGDQELIALAKNRFSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTDD
TSDPEKTVERVLDIANVLFHLEQKSKRVGRRHYCLVEHPQRSKKAVWHKLLSKQRKRAVV
ACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEEDEGTKR
VDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEKEME
KQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDY
LKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLF
RFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDE
QGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQ
DSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMF
LKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDY
EEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMG
SAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEM
QLAAQISESDLNERSANKEESEKERPEEQGPRMAFFSILTVRSALFALRYNILTLMRMLS
LKSLKKQMKKVKKMTVKDMVTAFFSSYWSIFMTLLHFVASVFRGFFRIICSLLLGGSLVE
GAKKIKVAELLANMPDPTQDEVRGDGEEGERKPLEAALPSEDLTDLKELTEESDLLSDIF
GLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQKAKEEEKEEKEETKSEPE
KAEGEDGEKEEKAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFY
NMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRSSSENAKVTSLDSSSHRIIAVHYV
LEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQ
PSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFS
DAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFA
AHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGD
TPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLA
IIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLF
FLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
NT seq 14904 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgggggcgagggcgaagacgagatccagttcctgcgaactgatgatgaagtg
gttctgcagtgcaccgcaaccatccacaaagaacaacagaagctatgcttggcagcagaa
ggatttggcaacagactttgtttcttggagtccacttccaattccaagaatgtgccccca
gacctctccatctgcacctttgtgctggagcagtccctctctgtccgggcgctgcaggag
atgctggctaacaccgtggagaaatcagaagggcaagttgatgtggaaaaatggaaattc
atgatgaagactgctcaaggtggtggtcatcgaacactcctctacggacatgccatattg
ctgcgccattcctatagtggcatgtatctgtgctgcctgtccacctcccggtcttcaact
gataagctggcttttgatgttggcttgcaagaggacaccacaggggaggcttgttggtgg
accatacaccctgcctctaagcagcgatcagaaggagaaaaagtacgagttggagatgac
ctcatcttagttagcgtgtcctctgaaaggtacttgcacttgtcttatggcaacggcagc
ttacacgtggatgccgctttccagcagactctctggagcgtggccccaatcagctcagga
agtgaggcagcccaagggtatctcattggtggtgatgtcctcaggttgctgcatggacac
atggacgagtgtctcactgtcccttcaggagaacatggtgaagagcagcggagaactgtt
cattatgaaggtggcgctgtgtctgttcatgcacgttccctttggagactagagacgcta
agagttgcgtggagtggaagccacataagatggggacagccattccgactacgccatgtc
acaacaggaaaatacttgagtctcatggaagacaaaaaccttctactcatggacaaagag
aaagctgatgtaaaatcaacagcatttaccttccggtcttccaaggaaaaattggatgta
ggggtgagaaaagaagtagatggcatgggaacatctgaaataaaatacggtgactcagta
tgctatatacaacatgtagacacaggcctatggcttacttaccagtctgtggacgtgaaa
tccgtgagaatgggatctatacaacgtaaggctattatgcatcatgaaggccacatggat
gatggcataagtttgtcgagatcccagcatgaagaatcacgcacagcccgagttatccgg
agcacagtcttccttttcaatagatttataaggggccttgatgctctcagcaagaaagcg
aaggcttccacagtcgatttgcctatagagtccgtaagcctaagtctgcaggatctcatt
ggctacttccaccccccagatgagcatttagagcatgaagacaaacagaacagactacga
gccctgaagaatcggcaaaatctcttccaggaagagggaatgatcaacctcgtgcttgag
tgcatagaccgtttgcacgtctacagcagtgcagcacactttgctgatgttgctgggcga
gaagcaggagagtcttggaaatccattctgaattctctgtatgagttgctggcggctcta
attagaggaaatcgtaaaaactgtgctcaattttctggctccctcgactggttgatcagc
agattggaaagactggaagcttcttcaggcattctggaagttttacactgtgttttagta
gaaagtccagaagctctaaatattattaaagaaggacatattaaatctattatctcactt
ttagacaaacatggaagaaatcacaaggttctggatgtcttgtgctcactctgtgtttgc
cacggggttgcagtccgttctaaccagcatctcatctgtgacaatctcctaccaggaaga
gacttgttattgcagacacgtcttgtgaaccatgtcagcagcatgagacccaatattttt
ctgggcgtcagtgaaggttctgctcagtataagaaatggtactatgaattgatggtggac
cacacagagccctttgtgacagctgaagcaactcacctgcgagtgggctgggcttccact
gaaggatattctccctaccctggagggggcgaagagtggggtggaaatggtgttggagat
gatctcttctcctatggatttgatggccttcatctctggtcaggttgtattgctcgtact
gtaagctcaccaaaccaacatctgttaagaactgatgatgtcatcagttgctgtttagat
ctgagtgccccaagcatctcgttccgaattaatggacaacctgttcaaggaatgtttgag
aatttcaacatcgatggcctcttctttccagtcgttagtttctctgcaggaataaaagta
cgctttctgcttggagggcgacatggagaattcaaatttcttcctccacctgggtatgct
ccttgttatgaagctgttctgccaaaagaaaagttgaaagtggaacacagccgagagtac
aagcaagaaagaacttacacacgcgacctgctgggccccacagtttccctgacgcaagct
gccttcacacccatccctgtggataccagccagatcgtgttgcctcctcatctagaaaga
ataagagaaaaactggcagagaatatccatgaactctgggttatgaataaaattgagctt
ggctggcagtatggtccggttagagatgacaacaagagacaacacccatgcctggtggag
ttctccaagctgcctgaacaggagcgcaattacaacttacaaatgtcgcttgagaccctg
aagactttgttggcattaggatgtcatgtgggtatatcagatgaacatgctgaagacaag
gtgaaaaaaatgaagctacccaagaattaccagctgacaagtggatacaagcctgcccct
atggacctgagctttatcaaactcaccccatcacaagaagcaatggtggacaagttggca
gaaaatgcacataatgtgtgggcgcgggatcgaatccggcagggctggacttatggcatc
caacaggacgtaaagaacagaagaaatcctcgccttgttccctacactcttctggatgac
cgaaccaagaaatccaacaaggacagcctccgcgaggctgtgcgcacgctgctggggtac
ggctacaacttggaagcaccagatcaagatcatgcagccagagccgaagtgtgcagcggc
accggggaaaggttccgaatcttccgtgccgagaagacctatgcagtgaaggccggacgg
tggtattttgaatttgagacggtcactgctggagacatgagggttggttggagtcgtcct
ggttgtcaaccggatcaggagcttggctcagatgaacgtgcctttgcctttgatggcttc
aaggcccagcggtggcatcagggcaatgaacactatgggcgctcttggcaagcaggcgat
gtcgtggggtgtatggttgacatgaacgaacacaccatgatgttcacactgaatggtgaa
atccttcttgatgattcaggctcagaactggctttcaaggactttgatgttggcgatgga
ttcatacctgtgtgtagccttggagtggctcaagtgggtaggatgaactttggaaaggat
gtcagcaccttgaaatatttcaccatctgtggcttacaagagggctatgaaccatttgcc
gttaatacaaacagggatattaccatgtggctgagcaagaggcttcctcagtttcttcaa
gttccatcaaaccatgaacatatagaggtgaccagaatagacggcaccatagacagttcc
ccatgtttaaaggtcactcagaagtcttttggttctcagaacagcaacactgatatcatg
ttttatcgcctgagcatgccgatcgagtgcgcggaggtcttctccaagacggtggctgga
gggctccctggggctggcctttttgggcccaagaatgacttggaagattatgatgctgat
tctgactttgaggttctgatgaagacagctcatggccatctagtgcccgatcgtgttgac
aaagacaaagaagctactaaaccagagtttaacaaccacaaagattatgcccaggaaaag
ccctctcgtctgaaacaaagatttttgcttagaagaacaaagccagattacagcacaagc
cattctgcaagactcaccgaagatgtccttgctgatgatcgggatgactatgatttcttg
atgcaaacgtccacgtactattactcagtgagaatctttcctggacaagaacctgctaat
gtctgggtgggctggattacatcagatttccatcagtatgacacaggctttgacttggac
agagttcgcacagtaacagttactctaggagatgaaaaaggaaaagtgcatgaaagcatc
aaacgcagcaactgctatatggtatgtgcgggtgagagcatgagccccgggcaaggacgc
aacaataatggactggagattggctgtgtggtggatgctgccagcgggctgctcacattc
attgccaatggcaaggaactgagcacatactatcaggtggaaccgagtacaaaattattt
cctgcggtttttgcacaagctacaagtcccaatgttttccagtttgagttgggaagaata
aagaatgtgatgcctctctcggcgggattattcaagagtgagcacaagaaccccgtgccg
cagtgccccccgcgcctccacgtgcagttcctgtcacacgtcctgtggagcagaatgccc
aaccagtttttgaaggtagatgtgtctcgaataagtgaacgccaaggctggttggtgcag
tgtttggatcctctgcagttcatgtctcttcatatccctgaggaaaacagatctgttgac
atcttagagttgacagagcaggaggaattgctgaaatttcactatcacactctccggctc
tactcagccgtctgtgctcttgggaaccaccgggtggcccatgccctgtgcagccatgtg
gatgaacctcagctcctctatgccattgagaacaagtacatgcctggtttgctgcgtgct
ggctactatgacctgctgattgacatccacctgagctcctatgccactgccaggctcatg
atgaacaacgagtacattgtccccatgacggaggagacgaagagcatcaccctgttccct
gatgagaacaaaaaacacggccttccagggatcggcctcagcacctccctcaggccacgg
atgcagttttcctcccccagttttgtaagcattagtaatgaatgttaccagtacagtcca
gagttcccactggacatcctcaagtccaaaaccatacagatgctgacagaagctgttaaa
gagggcagtcttcatgcccgggacccagttggagggactactgaattcctctttgtacct
ctcatcaagcttttctataccctgctgatcatgggcatctttcacaacgaggacttgaag
cacatcttgcagttgattgagcccagtgtgtttaaagaagctgccactccggaggaggag
agtgacacgctggagaaagagctcagtgtggacgatgcaaagctgcaaggagctggtgag
gaagaagccaaggggggcaagcggcccaaggaaggcctgctccaaatgaaactgccagag
ccagttaaattgcagatgtgcctactgcttcagtacctctgtgactgccaggtccggcac
cggatagaagccattgtagccttttcagatgattttgtggctaagctccaagacaatcaa
cgtttccgatacaacgaagtcatgcaagccttaaacatgtcagctgcactcacagccagg
aagacaaaggaatttagatcaccacctcaagaacagatcaatatgcttctcaattttaag
gatgacaaaagtgaatgtccatgtccagaagaaattcgtgaccaactattggatttccat
gaagatttgatgacacattgtggaattgagctggatgaagatgggtctctggatggaaac
agtgatttaacaattagagggcgtctgctatccctggtagaaaaggtgacatatctgaag
aagaagcaagcagaaaaaccagttgagagtgactccaaaaagtcctccactctgcagcag
ctgatttctgagaccatggtccgatgggctcaggagtctgtcattgaagaccccgagctg
gtgagggccatgtttgtgttgctccatcggcagtatgacggcattgggggtcttgttcgg
gccctgccaaagacctacacgataaatggtgtgtccgtggaggacaccatcaacctgctg
gcatcccttggtcagattcggtccctgctgagtgtgagaatgggcaaagaagaagagaag
ctcatgattcgtggattaggggatattatgaataacaaagtgttttaccagcaccctaat
ctcatgagggcactggggatgcacgagactgtgatggaggtcatggtgaacgtccttgga
ggtggagagtccaaggaaatcacctttcccaagatggtggccaactgttgccgttttctc
tgttacttctgtcgtataagtaggcagaatcaaaaagctatgtttgatcatctcagttat
ttactggaaaacagcagtgttggtcttgcctccccagctatgagaggttcaacaccactg
gatgtggctgcagcttcggtgatggataataatgaactagcattagctctgcgtgagccg
gatctagaaaaggtagttcgttatttggctggttgtggactgcaaagttgccagatgctg
gtgtctaagggctatccagacattgggtggaacccagttgaaggagagagatatcttgac
tttcttagatttgctgtcttctgtaatggggagagtgtggaggaaaatgcaaatgtcgtg
gtgagattgctcattcggaggcctgagtgttttggtcctgctttgagaggagaaggtggg
aatgggcttcttgcagcaatggaagaagccatcaaaatcgccgaggatccttcccgagat
ggtccctcaccaaatagcggatccagtaaaacacttgacacagaggaggaggaagatgac
actatccacatggggaacgcgatcatgaccttctattcagctttgattgacctcttggga
cgctgtgctcctgagatgcatttgattcatgccgggaagggagaagccatcagaattagg
tccattttgagatccctcattcccctgggagatttggtgggcgttatcagcatcgctttt
cagatgccaacaatagccaaagatgggaatgtggtggaacctgacatgtctgcggggttt
tgcccagatcacaaggcagccatggttttattccttgacagggtctatgggattgaggtt
caagacttcctcctccatcttcttgaggttggctttctgccagatctccgggcggctgct
tctttagatacggcagctttgagtgctacagacatggccttggccctcaatcggtacctt
tgcacagccgtcttgccattgttaacaagatgtgctcctctctttgctggcacagagcac
cacgcttctctcattgactcattacttcatactgtgtatagactttctaagggctgttca
cttaccaaagctcagcgggattccatagaagtttgtttactctctatttgtggacaactg
agaccttctatgatgcagcacttactcagaagattagtatttgatgttccattattaaat
gaacacgcaaagatgcctcttaaactgctgacaaatcattatgaaagatgctggaaatat
tactgcctgcctggagggtggggaaactttggtgctgcctcagaagaagaacttcattta
tcaagaaagttgttctggggcatttttgatgccctgtctcaaaagaaatatgaacaagaa
cttttcaaactggcactgccttgcctgagtgcagttgcgggagctttgcctccagactac
atggagtcaaattatgtcagtatgatggaaaaacagtcatcaatggattctgaagggaac
tttaacccacaacctgttgatacctcaaatattacaattcctgagaaattggaatacttc
attaacaaatatgcagaacactcccatgacaaatggtcaatggacaagttggcaaatgga
tggatttatggagaaatatattcagactcttctaaggttcagccattaatgaagccatat
aagctattgtctgaaaaggaaaaagaaatttatcgctggccaatcaaagaatctttaaaa
actatgctggcttggggctggagaattgaaagaactcgggagggagacagcatggccctt
tacaaccggactcgtcgtatttctcagacaagccaggtttctgtggacgctgcccatggt
tacagtccccgggccattgacatgagcaatgttacactatctagagacctgcatgctatg
gcagaaatgatggctgaaaactaccataatatatgggcaaagaaaaagaaaatggagttg
gagtccaaaggaggaggaaaccatcctctgctggtgccctatgatacactgacagccaaa
gagaaagccaaggatagagaaaaagcacaggacatcctcaagttcttgcagatcaatgga
tatgctgtatccagaggatttaaggacctggaactggacacgccttctattgagaaacga
tttgcctatagtttcctccaacaactcattcgctatgtggatgaagcccatcagtatatc
ctggagtttgatggtggcagcagaggcaaaggagaacatttcccttatgaacaagaaatc
aagttctttgcaaaagtcgttcttcctttaattgatcagtatttcaaaaaccatcgttta
tacttcttatctgcagcaagcagacctctctgctctggaggacatgcttccaacaaagag
aaagaaatggtgactagcctattctgcaaacttggagttcttgtcaggcataggatttca
ctatttggcaatgatgcaacatcaattgtcaactgtcttcatattttgggtcagactttg
gatgcaaggacagtgatgaagactggcctggagagtgttaaaagtgcactcagagctttt
ctggacaacgctgcagaggatctggagaagaccatggaaaacctcaagcagggccagttc
actcacacccgaaaccagcccaaaggggttactcagattatcaattacaccacagtggcc
ctgctgccaatgctgtcttcattatttgaacatattggccagcatcagttcggagaagac
ctaatattggaagatgtccaggtgtcttgttatagaattctgactagcttatatgctttg
ggaaccagcaagagtatttacgtggagaggcaacgttctgcattaggagaatgtctagct
gcctttgctggtgcttttcctgtagcatttttggaaactcatctggacaaacataatatt
tactccatctacaataccaagtcttcacgagaaagagcagctctcagtttgccaactaat
gtggaagatgtttgtccaaacataccgtctttggagaaactcatggaagaaatcgtggaa
ttagccgagtccggcattcgctacactcaaatgccacatgtcatggaagtcatactgccc
atgctttgcagctacatgtctcgttggtgggagcatggacctgagaacaatccagaacgg
gccgagatgtgctgcacagccctgaactcagagcacatgaacacacttctagggaacata
ttgaaaatcatatataataacttggggattgatgagggagcctggatgaagaggctagca
gtgttttcccagcctataataaataaagtgaaacctcagctcttgaaaactcatttcttg
ccgttaatggagaaactcaagaaaaaggcagctacggtggtgtctgaggaagaccacctg
aaagctgaggccaggggggacatgtcggaggcagaactcctcatcctagatgagttcacc
acactggccagagatctctatgccttctaccctctcttgattagatttgtggactataac
agggcaaagtggctaaaggagcctaacccagaagcagaggagctcttccgcatggtggct
gaagtgtttatctactggtcgaagtcccataatttcaaaagagaagagcagaacttcgtt
gtacagaatgaaatcaacaatatgtctttccttattactgataccaagtcaaagatgtca
aaggcagctgtttctgatcaggaaaggaagaaaatgaagcgcaaaggagatcggtattcc
atgcagacctctctgattgtagcagctctgaagcggttactgcccattgggttgaacatc
tgtgcccctggggaccaggagctcattgctctggccaaaaatcgatttagcctgaaagat
accgaggatgaagtacgagatataatccgcagcaatattcatttacaaggcaagttggag
gatcctgctattagatggcaaatggctctttacaaagacttaccaaacaggactgatgat
acctcagatccagagaagacggtagaaagagtattggatatagcaaatgtgctttttcat
cttgaacagaagtctaaacgtgtgggtcggagacattactgtctggtggaacatcctcag
agatctaaaaaggctgtatggcataaactactgtccaagcagaggaaaagggctgttgta
gcctgcttccggatggcccccttatataatctgccaaggcatcgggctgtcaatctcttt
cttcagggatatgaaaagtcttggattgaaacagaagaacattactttgaagataaactg
atagaagatttagcaaaacctggggctgaacctccagaagaagatgaaggcactaagaga
gttgatcctctacatcagctgatccttctgtttagtcggacagctttaacagagaaatgc
aaactggaggaagattttttatatatggcctatgcagatattatggcaaagagttgtcat
gatgaggaagatgacgatggtgaagaggaagtgaagagttttgaagaaaaagaaatggaa
aagcaaaagcttctataccagcaagcccgactccacgatcgtggcgcggctgagatggtg
ctacagacaatcagtgccagcaaaggtgaaactggaccaatggtagcagctactctgaaa
cttggaattgctattttaaatggtgggaactccacagtacagcagaaaatgcttgactac
ctcaaggagaaaaaggatgtgggcttctttcagagcctggccggcctgatgcagtcatgt
agtgtccttgacctaaatgcatttgagcgacaaaacaaagctgaaggtcttgggatggtg
acagaggaaggatcaggagaaaaggttctgcaggacgatgagttcacctgtgacctcttc
cgattcctgcaactactctgtgagggacacaactcagattttcagaattatctgagaact
cagactggcaataatacaactgtcaacataattatctccactgtagactacctactgaga
gttcaggaatcaattagtgacttttattggtattactctgggaaagatgttattgatgaa
caaggacaacggaatttctccaaagctatccaagtggcaaaacaagtctttaacactctt
acagagtatattcagggtccttgcactgggaatcaacagagtttggcacacagcaggctg
tgggatgctgtggtcggctttcttcatgtgtttgcccatatgcagatgaagctgtcgcag
gattccagtcaaattgagctattaaaagaattaatggatctgcagaaggatatggtggtc
atgttgctgtccatgttagaaggtaatgttgttaatggaacgattggcaaacagatggtg
gatatgcttgtggaatcttccaacaacgtggagatgattctcaaattttttgacatgttc
ttaaaactaaaggatttgacgtcgtctgatacttttaaagaatatgaccccgatggcaag
ggagtcatttccaagagggacttccacaaagcgatggagagccataagcactacacgcag
tcagaaacggaatttcttttgtcttgtgcggagacggatgagaatgaaaccctcgactac
gaagagttcgtcaaacgcttccacgaacctgcgaaggacatcggcttcaacgtcgccgtc
cttctgacaaacctctctgagcacatgcccaacgatacccgacttcagacttttctggaa
ttagcagagagcgtcctgaattatttccagccctttctgggccgcatcgaaatcatggga
agcgccaaacgcatcgagagggtctattttgaaatcagtgagtccagccgaacccagtgg
gagaagccccaggtcaaggagtccaaaagacagttcatatttgacgtggtcaacgaaggc
ggagagaaagagaagatggaactctttgtgaacttctgcgaggacaccatctttgaaatg
cagctggcggctcagatctcggagtcggacttgaacgagaggtcagcgaataaggaagaa
agcgagaaggagaggccggaagagcaggggccgaggatggctttcttctccattctgacg
gtcaggtcggccctgtttgcgctcaggtacaatatcttgacccttatgcgaatgctcagt
ctgaagagcctgaagaagcagatgaaaaaagtaaaaaagatgaccgtgaaggacatggtc
acggccttcttttcatcctactggagtattttcatgaccctcttgcacttcgtggccagc
gttttcagaggctttttccgcatcatttgcagcctgctgcttgggggaagcctcgtcgaa
ggtgctaaaaagatcaaagttgcagaactgttagccaacatgccagaccccactcaggat
gaggttagaggagatggggaggagggagagaggaaacccctggaagccgccctgccctcc
gaggatctgaccgacttaaaggagctgacagaggaaagtgaccttctttcggacatcttt
ggcctggatctgaagagagaaggaggacagtacaaactgattcctcataatccaaatgct
gggctcagtgacctcatgagcaacccagtccccatgcctgaggtgcaggaaaaatttcag
gaacagaaggcaaaagaagaagaaaaggaagaaaaagaagaaaccaaatctgaacctgaa
aaagccgagggagaagatggagaaaaagaagagaaagccaaggaagacaagggcaaacaa
aagttgaggcagcttcacacacacagatacggagaaccagaagtgccagagtcagcattc
tggaagaaaatcatagcatatcaacagaaacttctaaactattttgctcgcaacttttac
aacatgagaatgttagccttatttgtcgcatttgctatcaatttcatcttgctcttttat
aaggtctccacttcttctgtggttgaaggaaaggagctccccacgagaagttcaagtgaa
aatgccaaagtgacaagcctggacagcagctcccatagaatcatcgcagttcactatgta
ctagaggagagcagcggctacatggagcccacgttgcgtatcttagctattctgcacacg
gtcatttctttcttctgcatcattggatactactgcttgaaagtcccattggttattttt
aagcgagaaaaggaagtggcacggaaattggaatttgatgggctttatattacagaacag
ccttcagaagatgatattaaaggccagtgggatagactcgtaatcaacacacagtcattt
cccaacaactactgggacaaatttgttaaaagaaaggttatggataaatatggagagttc
tacggccgagacagaatcagtgaattacttggcatggacaaggcagctctggacttcagt
gatgccagagaaaagaagaagccaaagaaagacagctccttatcagctgtactgaactcc
attgatgtgaagtatcagatgtggaaactaggagtcgttttcactgacaactccttcctc
tacctagcctggtatatgactatgtctgttcttggacactataacaactttttttttgcc
gctcaccttctcgacattgctatgggattcaagacattaagaaccatcttgtcctcagta
actcacaatggcaaacagctcgtattaaccgttggcttattagctgttgttgtataccta
tacactgtggtggcattcaattttttccgaaaattctacaataaaagtgaagatggtgat
acaccagatatgaaatgtgacgatatgctaacatgctatatgttccacatgtatgttgga
gttcgtgctggaggagggatcggggatgaaatcgaagacccagcaggagatgaatatgag
atctatcgaatcatctttgacatcactttcttcttctttgttattgtcattctcttggcc
ataatacaaggtctaattattgatgcttttggagaactaagagaccaacaggaacaagtc
aaagaagacatggagaccaaatgcttcatctgtgggataggcaatgattacttcgacaca
gtgccacatggctttgaaacccacactttacaggagcacaacttggctaattacttgttt
tttctgatgtatcttataaacaaagatgaaacagaacacacaggacaggaatcttatgtc
tggaagatgtatcaagaaaggtgttgggaatttttcccagcaggggattgcttccggaaa
cagtatgaagaccagctaaattaa

DBGET integrated database retrieval system