KEGG   Homo sapiens (human): 627Help
Entry
627               CDS       T01001                                 

Gene name
BDNF, ANON2, BULN2
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
cAMP signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Disease
H00916  
Congenital central hypoventilation syndrome (CCHS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    627 (BDNF)
   04024 cAMP signaling pathway
    627 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    627 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    627 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    627 (BDNF)
   05034 Alcoholism
    627 (BDNF)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    627 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
11p13
AA seq 247 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLA
DTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA
NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY
FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT
LTIKRGR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatactttggttgcatgaaggctgccccc
atgaaagaagcaaacatccgaggacaaggtggcttggcctacccaggtgtgcggacccat
gggactctggagagcgtgaatgggcccaaggcaggttcaagaggcttgacatcattggct
gacactttcgaacacgtgatagaagagctgttggatgaggaccagaaagttcggcccaat
gaagaaaacaataaggacgcagacttgtacacgtccagggtgatgctcagtagtcaagtg
cctttggagcctcctcttctctttctgctggaggaatacaaaaattacctagatgctgca
aacatgtccatgagggtccggcgccactctgaccctgcccgccgaggggagctgagcgtg
tgtgacagtattagtgagtgggtaacggcggcagacaaaaagactgcagtggacatgtcg
ggcgggacggtcacagtccttgaaaaggtccctgtatcaaaaggccaactgaagcaatac
ttctacgagaccaagtgcaatcccatgggttacacaaaagaaggctgcaggggcatagac
aaaaggcattggaactcccagtgccgaactacccagtcgtacgtgcgggcccttaccatg
gatagcaaaaagagaattggctggcgattcataaggatagacacttcttgtgtatgtaca
ttgaccattaaaaggggaagatag

DBGET integrated database retrieval system