KEGG   Homo sapiens (human): 627Help
Entry
627               CDS       T01001                                 

Gene name
BDNF, ANON2, BULN2
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Disease
H00916  
Congenital central hypoventilation syndrome (CCHS)
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
11p13
AA seq 247 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLA
DTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA
NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY
FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT
LTIKRGR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatactttggttgcatgaaggctgccccc
atgaaagaagcaaacatccgaggacaaggtggcttggcctacccaggtgtgcggacccat
gggactctggagagcgtgaatgggcccaaggcaggttcaagaggcttgacatcattggct
gacactttcgaacacgtgatagaagagctgttggatgaggaccagaaagttcggcccaat
gaagaaaacaataaggacgcagacttgtacacgtccagggtgatgctcagtagtcaagtg
cctttggagcctcctcttctctttctgctggaggaatacaaaaattacctagatgctgca
aacatgtccatgagggtccggcgccactctgaccctgcccgccgaggggagctgagcgtg
tgtgacagtattagtgagtgggtaacggcggcagacaaaaagactgcagtggacatgtcg
ggcgggacggtcacagtccttgaaaaggtccctgtatcaaaaggccaactgaagcaatac
ttctacgagaccaagtgcaatcccatgggttacacaaaagaaggctgcaggggcatagac
aaaaggcattggaactcccagtgccgaactacccagtcgtacgtgcgggcccttaccatg
gatagcaaaaagagaattggctggcgattcataaggatagacacttcttgtgtatgtaca
ttgaccattaaaaggggaagatag

DBGET integrated database retrieval system