KEGG   Homo sapiens (human): 6351Help
Entry
6351              CDS       T01001                                 

Gene name
CCL4, ACT2, AT744.1, G-26, HC21, LAG-1, LAG1, MIP-1-beta, MIP1B, MIP1B1, SCYA2, SCYA4
Definition
(RefSeq) C-C motif chemokine ligand 4
  KO
K12964  C-C motif chemokine 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    6351 (CCL4)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6351 (CCL4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    6351 (CCL4)
   04623 Cytosolic DNA-sensing pathway
    6351 (CCL4)
   04062 Chemokine signaling pathway
    6351 (CCL4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    6351 (CCL4)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6351 (CCL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6351
NCBI-ProteinID: NP_002975
OMIM: 182284
HGNC: 10630
Ensembl: ENSG00000275302
Vega: OTTHUMG00000188414
Pharos: P13236(Tbio)
UniProt: P13236
LinkDB All DBs
Structure
PDB: 

Jmol
Position
17q12
AA seq 92 aa AA seqDB search
MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVFQTKRSKQVCADPSESWVQEYVYDLELN
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctgcgtgactgtcctgtctctcctcatgctagtagctgccttctgctctcca
gcgctctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccgcg
aggaagcttcctcgcaactttgtggtagattactatgagaccagcagcctctgctcccag
ccagctgtggtattccaaaccaaaagaagcaagcaagtctgtgctgatcccagtgaatcc
tgggtccaggagtacgtgtatgacctggaactgaactga

DBGET integrated database retrieval system