KEGG   Homo sapiens (human): 6351Help
Entry
6351              CDS       T01001                                 

Gene name
CCL4, ACT2, AT744.1, G-26, HC21, LAG-1, LAG1, MIP-1-beta, MIP1B, MIP1B1, SCYA2, SCYA4
Definition
chemokine (C-C motif) ligand 4
Orthology
K12964  
C-C motif chemokine 4
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    6351 (CCL4)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6351 (CCL4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    6351 (CCL4)
   04623 Cytosolic DNA-sensing pathway
    6351 (CCL4)
   04062 Chemokine signaling pathway
    6351 (CCL4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    6351 (CCL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
17q12
AA seq 92 aa AA seqDB search
MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVFQTKRSKQVCADPSESWVQEYVYDLELN
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctgcgtgactgtcctgtctctcctcatgctagtagctgccttctgctctcca
gcgctctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacactgcg
aggaagcttcctcgcaactttgtggtagattactatgagaccagcagcctctgctcccag
ccagctgtggtattccaaaccaaaagaagcaagcaagtctgtgctgatcccagtgaatcc
tgggtccaggagtacgtgtatgacctggaactgaactga

DBGET integrated database retrieval system