KEGG   Homo sapiens (human): 6376Help
Entry
6376              CDS       T01001                                 

Gene name
CX3CL1, ABCD-3, C3Xkine, CXC3, CXC3C, NTN, NTT, SCYD1, fractalkine, neurotactin
Definition
chemokine (C-X3-C motif) ligand 1
Orthology
K05508  
C-X3-C motif chemokine 1
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
TNF signaling pathway
Class
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
16q13
AA seq 397 aa AA seqDB search
MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGK
RAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGG
MDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGP
VGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENA
PSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSRE
PVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMF
TYQSLQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctccgatatctctgtcgtggctgctccgcttggccaccttctgccatctgactgtc
ctgctggctggacagcaccacggtgtgacgaaatgcaacatcacgtgcagcaagatgaca
tcaaagatacctgtagctttgctcatccactatcaacagaaccaggcatcatgcggcaaa
cgcgcaatcatcttggagacgagacagcacaggctgttctgtgccgacccgaaggagcaa
tgggtcaaggacgcgatgcagcatctggaccgccaggctgctgccctaactcgaaatggc
ggcaccttcgagaagcagatcggcgaggtgaagcccaggaccacccctgccgccggggga
atggacgagtctgtggtcctggagcccgaagccacaggcgaaagcagtagcctggagccg
actccttcttcccaggaagcacagagggccctggggacctccccagagctgccgacgggc
gtgactggttcctcagggaccaggctccccccgacgccaaaggctcaggatggagggcct
gtgggcacggagcttttccgagtgcctcccgtctccactgccgccacgtggcagagttct
gctccccaccaacctgggcccagcctctgggctgaggcaaagacctctgaggccccgtcc
acccaggacccctccacccaggcctccactgcgtcctccccagccccagaggagaatgct
ccgtctgaaggccagcgtgtgtggggtcagggacagagccccaggccagagaactctctg
gagcgggaggagatgggtcccgtgccagcgcacacggatgccttccaggactgggggcct
ggcagcatggcccacgtctctgtggtccctgtctcctcagaagggacccccagcagggag
ccagtggcttcaggcagctggacccctaaggctgaggaacccatccatgccaccatggac
ccccagaggctgggcgtccttatcactcctgtccctgacgcccaggctgccacccggagg
caggcggtggggctgctggccttccttggcctcctcttctgcctgggggtggccatgttc
acctaccagagcctccagggctgccctcgaaagatggcaggagagatggcggagggcctt
cgctacatcccccggagctgtggtagtaattcatatgtcctggtgcccgtgtga

DBGET integrated database retrieval system