KEGG   Homo sapiens (human): 6376Help
Entry
6376              CDS       T01001                                 

Gene name
CX3CL1, ABCD-3, C3Xkine, CXC3, CXC3C, NTN, NTT, SCYD1, fractalkine, neurotactin
Definition
(RefSeq) chemokine (C-X3-C motif) ligand 1
  KO
K05508  
C-X3-C motif chemokine 1
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    6376 (CX3CL1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6376 (CX3CL1)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6376 (CX3CL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
16q13
AA seq 312 aa AA seqDB search
MQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEPTPSSQ
EAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGPVGTELFRVPPVSTAATWQSSAPHQP
GPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQGQSPRPENSLEREEM
GPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSREPVASGSWTPKAEEPIHATMDPQRLG
VLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMFTYQSLQGCPRKMAGEMAEGLRYIPR
SCGSNSYVLVPV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatctggaccgccaggctgctgccctaactcgaaatggcggcaccttcgagaag
cagatcggcgaggtgaagcccaggaccacccctgccgccgggggaatggacgagtctgtg
gtcctggagcccgaagccacaggcgaaagcagtagcctggagccgactccttcttcccag
gaagcacagagggccctggggacctccccagagctgccgacgggcgtgactggttcctca
gggaccaggctccccccgacgccaaaggctcaggatggagggcctgtgggcacggagctt
ttccgagtgcctcccgtctccactgccgccacgtggcagagttctgctccccaccaacct
gggcccagcctctgggctgaggcaaagacctctgaggccccgtccacccaggacccctcc
acccaggcctccactgcgtcctccccagccccagaggagaatgctccgtctgaaggccag
cgtgtgtggggtcagggacagagccccaggccagagaactctctggagcgggaggagatg
ggtcccgtgccagcgcacacggatgccttccaggactgggggcctggcagcatggcccac
gtctctgtggtccctgtctcctcagaagggacccccagcagggagccagtggcttcaggc
agctggacccctaaggctgaggaacccatccatgccaccatggacccccagaggctgggc
gtccttatcactcctgtccctgacgcccaggctgccacccggaggcaggcggtggggctg
ctggccttccttggcctcctcttctgcctgggggtggccatgttcacctaccagagcctc
cagggctgccctcgaaagatggcaggagagatggcggagggccttcgctacatcccccgg
agctgtggtagtaattcatatgtcctggtgcccgtgtga

DBGET integrated database retrieval system