KEGG   Homo sapiens (human): 6390Help
Entry
6390              CDS       T01001                                 

Gene name
SDHB, CWS2, IP, PGL4, SDH, SDH1, SDH2, SDHIP
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hsa_M00148  Succinate dehydrogenase (ubiquinone)
Disease
H01222  Cowden syndrome
H01510  Malignant paraganglioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6390 (SDHB)
  Energy metabolism
   00190 Oxidative phosphorylation
    6390 (SDHB)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    6390 (SDHB)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    6390 (SDHB)
   05012 Parkinson's disease
    6390 (SDHB)
   05016 Huntington's disease
    6390 (SDHB)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    6390 (SDHB)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     6390 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 6390
NCBI-ProteinID: NP_002991
OMIM: 185470
HGNC: 10681
Ensembl: ENSG00000117118
Vega: OTTHUMG00000002289
Pharos: P21912(Tbio)
UniProt: P21912
LinkDB All DBs
Position
1p36.13
AA seq 280 aa AA seqDB search
MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQT
YEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgccctctccttgaggcgccggttgccggccacaacccttggcgga
gcctgcctgcaggcctcccgaggagcccagacagctgcagccacagctccccgtatcaag
aaatttgccatctatcgatgggacccagacaaggctggagacaaacctcatatgcagact
tatgaagttgaccttaataaatgtggccccatggtattggatgctttaatcaagattaag
aatgaagttgactctactttgaccttccgaagatcatgcagagaaggcatctgtggctct
tgtgcaatgaacatcaatggaggcaacactctagcttgcacccgaaggattgacaccaac
ctcaataaggtctcaaaaatctaccctcttccacacatgtatgtgataaaggatcttgtt
cccgatttgagcaacttctatgcacagtacaaatccattgagccttatttgaagaagaag
gatgaatctcaggaaggcaagcagcagtatctgcagtccatagaagagcgtgagaaactg
gacgggctctacgagtgcattctctgtgcctgctgtagcaccagctgccccagctactgg
tggaacggagacaaatatctggggcctgcagttcttatgcaggcctatcgctggatgatt
gactccagagatgacttcacagaggagcgcctggccaagctgcaggacccattctctcta
taccgctgccacaccatcatgaactgcacaaggacctgtcctaagggtctgaatccaggg
aaagctattgcagagatcaagaaaatgatggcaacctataaggagaagaaagcttcagtt
taa

DBGET integrated database retrieval system