KEGG   Homo sapiens (human): 64127Help
Entry
64127             CDS       T01001                                 

Gene name
NOD2, ACUG, BLAU, CARD15, CD, CLR16.3, IBD1, NLRC2, NOD2B, PSORAS1
Definition
nucleotide-binding oligomerization domain containing 2
Orthology
K10165  
nucleotide-binding oligomerization domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
TNF signaling pathway
Shigellosis
Tuberculosis
Inflammatory bowel disease (IBD)
Disease
H00285  
Blau syndrome
H00286  
Crohn's disease
H01309  
Sarcoidosis, early-onset
H01358  
Atopic dermatitis
Class
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:hsa04621]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
16q21
AA seq 1040 aa AA seqDB search
MGEEGGSASHDEEERASVLLGHSPGCEMCSQEAFQAQRSQLVELLVSGSLEGFESVLDWL
LSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLH
GCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQR
ARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEAATCKKYMAKLRTTVSAQSRFLSTY
DGAETLCLEDIYTENVLEVWADVGMAGPPQKSPATLGLEELFSTPGHLNDDADTVLVVGE
AGSGKSTLLQRLHLLWAAGQDFQEFLFVFPFSCRQLQCMAKPLSVRTLLFEHCCWPDVGQ
EDIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTSVQTLLFNLLQGNLLKNAR
KVVTSRPAAVSAFLRKYIRTEFNLKGFSEQGIELYLRKRHHEPGVADRLIRLLQETSALH
GLCHLPVFSWMVSKCHQELLLQEGGSPKTTTDMYLLILQHFLLHATPPDSASQGLGPSLL
RGRLPTLLHLGRLALWGLGMCCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLE
FLHITFQCFFAAFYLALSADVPPALLRHLFNCGRPGNSPMARLLPTMCIQASEGKDSSVA
ALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFH
SIPPAAPGEAKSVHAMPGFIWLIRSLYEMQEERLARKAARGLNVGHLKLTFCSVGPTECA
ALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKALYLRDNNISDRGICKLIECAL
HCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTS
LQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEEL
CLEENHLQDEGVCSLAEGLKKNSSLKILKLSNNCITYLGAEALLQALERNDTILEVWLRG
NTFSLEEVDKLGCRDTRLLL
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atgggggaagagggtggttcagcctctcacgatgaggaggaaagagcaagtgtcctcctc
ggacattctccgggttgtgaaatgtgctcgcaggaggcttttcaggcacagaggagccag
ctggtcgagctgctggtctcagggtccctggaaggcttcgagagtgtcctggactggctg
ctgtcctgggaggtcctctcctgggaggactacgagggcttccacctcctgggccagcct
ctctcccacttggccaggcgccttctggacaccgtctggaataagggtacttgggcctgt
cagaagctcatcgcggctgcccaagaagcccaggccgacagccagtcccccaagctgcat
ggctgctgggacccccactcgctccacccagcccgagacctgcagagtcaccggccagcc
attgtcaggaggctccacagccatgtggagaacatgctggacctggcatgggagcggggt
ttcgtcagccagtatgaatgtgatgaaatcaggttgccgatcttcacaccgtcccagagg
gcaagaaggctgcttgatcttgccacggtgaaagcgaatggattggctgccttccttcta
caacatgttcaggaattaccagtcccattggccctgcctttggaagctgccacatgcaag
aagtatatggccaagctgaggaccacggtgtctgctcagtctcgcttcctcagtacctat
gatggagcagagacgctctgcctggaggacatatacacagagaatgtcctggaggtctgg
gcagatgtgggcatggctggacccccgcagaagagcccagccaccctgggcctggaggag
ctcttcagcacccctggccacctcaatgacgatgcggacactgtgctggtggtgggtgag
gcgggcagtggcaagagcacgctcctgcagcggctgcacttgctgtgggctgcagggcaa
gacttccaggaatttctctttgtcttcccattcagctgccggcagctgcagtgcatggcc
aaaccactctctgtgcggactctactctttgagcactgctgttggcctgatgttggtcaa
gaagacatcttccagttactccttgaccaccctgaccgtgtcctgttaacctttgatggc
tttgacgagttcaagttcaggttcacggatcgtgaacgccactgctccccgaccgacccc
acctctgtccagaccctgctcttcaaccttctgcagggcaacctgctgaagaatgcccgc
aaggtggtgaccagccgtccggccgctgtgtcggcgttcctcaggaagtacatccgcacc
gagttcaacctcaagggcttctctgaacagggcatcgagctgtacctgaggaagcgccat
catgagcccggggtggcggaccgcctcatccgcctgctccaagagacctcagccctgcac
ggtttgtgccacctgcctgtcttctcatggatggtgtccaaatgccaccaggaactgttg
ctgcaggagggggggtccccaaagaccactacagatatgtacctgctgattctgcagcat
tttctgctgcatgccacccccccagactcagcttcccaaggtctgggacccagtcttctt
cggggccgcctccccaccctcctgcacctgggcagactggctctgtggggcctgggcatg
tgctgctacgtgttctcagcccagcagctccaggcagcacaggtcagccctgatgacatt
tctcttggcttcctggtgcgtgccaaaggtgtcgtgccagggagtacggcgcccctggaa
ttccttcacatcactttccagtgcttctttgccgcgttctacctggcactcagtgctgat
gtgccaccagctttgctcagacacctcttcaattgtggcaggccaggcaactcaccaatg
gccaggctcctgcccacgatgtgcatccaggcctcggagggaaaggacagcagcgtggca
gctttgctgcagaaggccgagccgcacaaccttcagatcacagcagccttcctggcaggg
ctgttgtcccgggagcactggggcctgctggctgagtgccagacatctgagaaggccctg
ctccggcgccaggcctgtgcccgctggtgtctggcccgcagcctccgcaagcacttccac
tccatcccgccagctgcaccgggtgaggccaagagcgtgcatgccatgcccgggttcatc
tggctcatccggagcctgtacgagatgcaggaggagcggctggctcggaaggctgcacgt
ggcctgaatgttgggcacctcaagttgacattttgcagtgtgggccccactgagtgtgct
gccctggcctttgtgctgcagcacctccggcggcccgtggccctgcagctggactacaac
tctgtgggtgacattggcgtggagcagctgctgccttgccttggtgtctgcaaggctctg
tatttgcgcgataacaatatctcagaccgaggcatctgcaagctcattgaatgtgctctt
cactgcgagcaattgcagaagttagctctattcaacaacaaattgactgacggctgtgca
cactccatggctaagctccttgcatgcaggcagaacttcttggcattgaggctggggaat
aactacatcactgccgcgggagcccaagtgctggccgaggggctccgaggcaacacctcc
ttgcagttcctgggattctggggcaacagagtgggtgacgagggggcccaggccctggct
gaagccttgggtgatcaccagagcttgaggtggctcagcctggtggggaacaacattggc
agtgtgggtgcccaagccttggcactgatgctggcaaagaacgtcatgctagaagaactc
tgcctggaggagaaccatctccaggatgaaggtgtatgttctctcgcagaaggactgaag
aaaaattcaagtttgaaaatcctgaagttgtccaataactgcatcacctacctaggggca
gaagccctcctgcaggcccttgaaaggaatgacaccatcctggaagtctggctccgaggg
aacactttctctctagaggaggttgacaagctcggctgcagggacaccagactcttgctt
tga

DBGET integrated database retrieval system