KEGG   Homo sapiens (human): 64127Help
Entry
64127             CDS       T01001                                 

Gene name
NOD2, ACUG, BLAU, CARD15, CD, CLR16.3, IBD1, NLRC2, NOD2B, PSORAS1
Definition
nucleotide-binding oligomerization domain containing 2
Orthology
K10165  
nucleotide-binding oligomerization domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
TNF signaling pathway
Shigellosis
Tuberculosis
Inflammatory bowel disease (IBD)
Disease
H00285  
Blau syndrome
H00286  
Crohn's disease
H01309  
Sarcoidosis, early-onset
H01358  
Atopic dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    64127 (NOD2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    64127 (NOD2)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    64127 (NOD2)
  Infectious diseases
   05131 Shigellosis
    64127 (NOD2)
   05152 Tuberculosis
    64127 (NOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
16q21
AA seq 1013 aa AA seqDB search
MCSQEAFQAQRSQLVELLVSGSLEGFESVLDWLLSWEVLSWEDYEGFHLLGQPLSHLARR
LLDTVWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHS
HVENMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELP
VPLALPLEAATCKKYMAKLRTTVSAQSRFLSTYDGAETLCLEDIYTENVLEVWADVGMAG
PPQKSPATLGLEELFSTPGHLNDDADTVLVVGEAGSGKSTLLQRLHLLWAAGQDFQEFLF
VFPFSCRQLQCMAKPLSVRTLLFEHCCWPDVGQEDIFQLLLDHPDRVLLTFDGFDEFKFR
FTDRERHCSPTDPTSVQTLLFNLLQGNLLKNARKVVTSRPAAVSAFLRKYIRTEFNLKGF
SEQGIELYLRKRHHEPGVADRLIRLLQETSALHGLCHLPVFSWMVSKCHQELLLQEGGSP
KTTTDMYLLILQHFLLHATPPDSASQGLGPSLLRGRLPTLLHLGRLALWGLGMCCYVFSA
QQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLEFLHITFQCFFAAFYLALSADVPPALLR
HLFNCGRPGNSPMARLLPTMCIQASEGKDSSVAALLQKAEPHNLQITAAFLAGLLSREHW
GLLAECQTSEKALLRRQACARWCLARSLRKHFHSIPPAAPGEAKSVHAMPGFIWLIRSLY
EMQEERLARKAARGLNVGHLKLTFCSVGPTECAALAFVLQHLRRPVALQLDYNSVGDIGV
EQLLPCLGVCKALYLRDNNISDRGICKLIECALHCEQLQKLALFNNKLTDGCAHSMAKLL
ACRQNFLALRLGNNYITAAGAQVLAEGLRGNTSLQFLGFWGNRVGDEGAQALAEALGDHQ
SLRWLSLVGNNIGSVGAQALALMLAKNVMLEELCLEENHLQDEGVCSLAEGLKKNSSLKI
LKLSNNCITYLGAEALLQALERNDTILEVWLRGNTFSLEEVDKLGCRDTRLLL
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcgcaggaggcttttcaggcacagaggagccagctggtcgagctgctggtctca
gggtccctggaaggcttcgagagtgtcctggactggctgctgtcctgggaggtcctctcc
tgggaggactacgagggcttccacctcctgggccagcctctctcccacttggccaggcgc
cttctggacaccgtctggaataagggtacttgggcctgtcagaagctcatcgcggctgcc
caagaagcccaggccgacagccagtcccccaagctgcatggctgctgggacccccactcg
ctccacccagcccgagacctgcagagtcaccggccagccattgtcaggaggctccacagc
catgtggagaacatgctggacctggcatgggagcggggtttcgtcagccagtatgaatgt
gatgaaatcaggttgccgatcttcacaccgtcccagagggcaagaaggctgcttgatctt
gccacggtgaaagcgaatggattggctgccttccttctacaacatgttcaggaattacca
gtcccattggccctgcctttggaagctgccacatgcaagaagtatatggccaagctgagg
accacggtgtctgctcagtctcgcttcctcagtacctatgatggagcagagacgctctgc
ctggaggacatatacacagagaatgtcctggaggtctgggcagatgtgggcatggctgga
cccccgcagaagagcccagccaccctgggcctggaggagctcttcagcacccctggccac
ctcaatgacgatgcggacactgtgctggtggtgggtgaggcgggcagtggcaagagcacg
ctcctgcagcggctgcacttgctgtgggctgcagggcaagacttccaggaatttctcttt
gtcttcccattcagctgccggcagctgcagtgcatggccaaaccactctctgtgcggact
ctactctttgagcactgctgttggcctgatgttggtcaagaagacatcttccagttactc
cttgaccaccctgaccgtgtcctgttaacctttgatggctttgacgagttcaagttcagg
ttcacggatcgtgaacgccactgctccccgaccgaccccacctctgtccagaccctgctc
ttcaaccttctgcagggcaacctgctgaagaatgcccgcaaggtggtgaccagccgtccg
gccgctgtgtcggcgttcctcaggaagtacatccgcaccgagttcaacctcaagggcttc
tctgaacagggcatcgagctgtacctgaggaagcgccatcatgagcccggggtggcggac
cgcctcatccgcctgctccaagagacctcagccctgcacggtttgtgccacctgcctgtc
ttctcatggatggtgtccaaatgccaccaggaactgttgctgcaggagggggggtcccca
aagaccactacagatatgtacctgctgattctgcagcattttctgctgcatgccaccccc
ccagactcagcttcccaaggtctgggacccagtcttcttcggggccgcctccccaccctc
ctgcacctgggcagactggctctgtggggcctgggcatgtgctgctacgtgttctcagcc
cagcagctccaggcagcacaggtcagccctgatgacatttctcttggcttcctggtgcgt
gccaaaggtgtcgtgccagggagtacggcgcccctggaattccttcacatcactttccag
tgcttctttgccgcgttctacctggcactcagtgctgatgtgccaccagctttgctcaga
cacctcttcaattgtggcaggccaggcaactcaccaatggccaggctcctgcccacgatg
tgcatccaggcctcggagggaaaggacagcagcgtggcagctttgctgcagaaggccgag
ccgcacaaccttcagatcacagcagccttcctggcagggctgttgtcccgggagcactgg
ggcctgctggctgagtgccagacatctgagaaggccctgctccggcgccaggcctgtgcc
cgctggtgtctggcccgcagcctccgcaagcacttccactccatcccgccagctgcaccg
ggtgaggccaagagcgtgcatgccatgcccgggttcatctggctcatccggagcctgtac
gagatgcaggaggagcggctggctcggaaggctgcacgtggcctgaatgttgggcacctc
aagttgacattttgcagtgtgggccccactgagtgtgctgccctggcctttgtgctgcag
cacctccggcggcccgtggccctgcagctggactacaactctgtgggtgacattggcgtg
gagcagctgctgccttgccttggtgtctgcaaggctctgtatttgcgcgataacaatatc
tcagaccgaggcatctgcaagctcattgaatgtgctcttcactgcgagcaattgcagaag
ttagctctattcaacaacaaattgactgacggctgtgcacactccatggctaagctcctt
gcatgcaggcagaacttcttggcattgaggctggggaataactacatcactgccgcggga
gcccaagtgctggccgaggggctccgaggcaacacctccttgcagttcctgggattctgg
ggcaacagagtgggtgacgagggggcccaggccctggctgaagccttgggtgatcaccag
agcttgaggtggctcagcctggtggggaacaacattggcagtgtgggtgcccaagccttg
gcactgatgctggcaaagaacgtcatgctagaagaactctgcctggaggagaaccatctc
caggatgaaggtgtatgttctctcgcagaaggactgaagaaaaattcaagtttgaaaatc
ctgaagttgtccaataactgcatcacctacctaggggcagaagccctcctgcaggccctt
gaaaggaatgacaccatcctggaagtctggctccgagggaacactttctctctagaggag
gttgacaagctcggctgcagggacaccagactcttgctttga

DBGET integrated database retrieval system