KEGG   Homo sapiens (human): 64240Help
Entry
64240             CDS       T01001                                 

Gene name
ABCG5, STSL
Definition
ATP-binding cassette, sub-family G (WHITE), member 5
Orthology
K05683  
ATP-binding cassette, subfamily G (WHITE), member 5 (sterolin 1)
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Fat digestion and absorption
Bile secretion
Disease
H00152  
Sitosterolemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    64240 (ABCG5)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    64240 (ABCG5)
   04975 Fat digestion and absorption
    64240 (ABCG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
2p21
AA seq 651 aa AA seqDB search
MGDLSSLTPGGSMGLQVNRGSQSSLEGAPATAPEPHSLGILHASYSVSHRVRPWWDITSC
RQQWTRQILKDVSLYVESGQIMCILGSSGSGKTTLLDAMSGRLGRAGTFLGEVYVNGRAL
RREQFQDCFSYVLQSDTLLSSLTVRETLHYTALLAIRRGNPGSFQKKVEAVMAELSLSHV
ADRLIGNYSLGGISTGERRRVSIAAQLLQDPKVMLFDEPTTGLDCMTANQIVVLLVELAR
RNRIVVLTIHQPRSELFQLFDKIAILSFGELIFCGTPAEMLDFFNDCGYPCPEHSNPFDF
YMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICHKTLKNIERMKHLKTLPMVPFKTKD
SPGVFSKLGVLLRRVTRNLVRNKLAVITRLLQNLIMGLFLLFFVLRVRSNVLKGAIQDRV
GLLYQFVGATPYTGMLNAVNLFPVLRAVSDQESQDGLYQKWQMMLAYALHVLPFSVVATM
IFSSVCYWTLGLHPEVARFGYFSAALLAPHLIGEFLTLVLLGIVQNPNIVNSVVALLSIA
GVLVGSGFLRNIQEMPIPFKIISYFTFQKYCSEILVVNEFYGLNFTCGSSNVSVTTNPMC
AFTQGIQFIEKTCPGATSRFTMNFLILYSFIPALVILGIVVFKIRDHLISR
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacctctcatctttgacccccggagggtccatgggtctccaagtaaacagaggc
tcccagagctccctggagggggctcctgccaccgccccggagcctcacagcctgggcatc
ctccatgcctcctacagcgtcagccaccgcgtgaggccctggtgggacatcacatcttgc
cggcagcagtggaccaggcagatcctcaaagatgtctccttgtacgtggagagcgggcag
atcatgtgcatcctaggaagctcaggctccgggaaaaccacgctgctggacgccatgtcc
gggaggctggggcgcgcggggaccttcctgggggaggtgtatgtgaacggccgggcgctg
cgccgggagcagttccaggactgcttctcctacgtcctgcagagcgacaccctgctgagc
agcctcaccgtgcgcgagacgctgcactacaccgcgctgctggccatccgccgcggcaat
cccggctccttccagaagaaggtggaggccgtcatggcagagctgagtctgagccatgtg
gcagaccgactgattggcaactacagcttggggggcatttccacgggtgagcggcgccgg
gtctccatcgcagcccagctgctccaggatcctaaggtcatgctgtttgatgagccaacc
acaggcctggactgcatgactgctaatcagattgtcgtcctcctggtggaactggctcgc
aggaaccgaattgtggttctcaccattcaccagccccgttctgagctttttcagctcttt
gacaaaattgccatcctgagcttcggagagctgattttctgtggcacgccagcggaaatg
cttgatttcttcaatgactgcggttacccttgtcctgaacattcaaacccttttgacttc
tatatggacctgacgtcagtggatacccaaagcaaggaacgggaaatagaaacctccaag
agagtccagatgatagaatctgcctacaagaaatcagcaatttgtcataaaactttgaag
aatattgaaagaatgaaacacctgaaaacgttaccaatggttcctttcaaaaccaaagat
tctcctggagttttctctaaactgggtgttctcctgaggagagtgacaagaaacttggtg
agaaataagctggcagtgattacgcgtctccttcagaatctgatcatgggtttgttcctc
cttttcttcgttctgcgggtccgaagcaatgtgctaaagggtgctatccaggaccgcgta
ggtctcctttaccagtttgtgggcgccaccccgtacacaggcatgctgaacgctgtgaat
ctgtttcccgtgctgcgagctgtcagcgaccaggagagtcaggacggcctctaccagaag
tggcagatgatgctggcctatgcactgcacgtcctccccttcagcgttgttgccaccatg
attttcagcagtgtgtgctactggacgctgggcttacatcctgaggttgcccgatttgga
tatttttctgctgctctcttggccccccacttaattggtgaatttctaactcttgtgcta
cttggtatcgtccaaaatccaaatatagtcaacagtgtagtggctctgctgtccattgcg
ggggtgcttgttggatctggattcctcagaaacatacaagaaatgcccattccttttaaa
atcatcagttattttacattccaaaaatattgcagtgagattcttgtagtcaatgagttc
tacggactgaatttcacttgtggcagctcaaatgtttctgtgacaactaatccaatgtgt
gccttcactcaaggaattcaattcattgagaaaacctgcccaggtgcaacatctagattc
acaatgaactttctgattttgtattcatttattccagctcttgtcatcctaggaatagtt
gttttcaaaataagggatcatctcattagcaggtag

DBGET integrated database retrieval system