KEGG   Homo sapiens (human): 64240Help
Entry
64240             CDS       T01001                                 

Gene name
ABCG5, STSL
Definition
ATP-binding cassette, sub-family G (WHITE), member 5
Orthology
K05683  
ATP-binding cassette, subfamily G (WHITE), member 5 (sterolin 1)
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Fat digestion and absorption
Bile secretion
Disease
H00152  
Sitosterolemia
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:hsa02010]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
Organismal Systems; Digestive system; Fat digestion and absorption [PATH:hsa04975]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
2p21
AA seq 651 aa AA seqDB search
MGDLSSLTPGGSMGLQVNRGSQSSLEGAPATAPEPHSLGILHASYSVSHRVRPWWDITSC
RQQWTRQILKDVSLYVESGQIMCILGSSGSGKTTLLDAMSGRLGRAGTFLGEVYVNGRAL
RREQFQDCFSYVLQSDTLLSSLTVRETLHYTALLAIRRGNPGSFQKKVEAVMAELSLSHV
ADRLIGNYSLGGISTGERRRVSIAAQLLQDPKVMLFDEPTTGLDCMTANQIVVLLVELAR
RNRIVVLTIHQPRSELFQLFDKIAILSFGELIFCGTPAEMLDFFNDCGYPCPEHSNPFDF
YMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICHKTLKNIERMKHLKTLPMVPFKTKD
SPGVFSKLGVLLRRVTRNLVRNKLAVITRLLQNLIMGLFLLFFVLRVRSNVLKGAIQDRV
GLLYQFVGATPYTGMLNAVNLFPVLRAVSDQESQDGLYQKWQMMLAYALHVLPFSVVATM
IFSSVCYWTLGLHPEVARFGYFSAALLAPHLIGEFLTLVLLGIVQNPNIVNSVVALLSIA
GVLVGSGFLRNIQEMPIPFKIISYFTFQKYCSEILVVNEFYGLNFTCGSSNVSVTTNPMC
AFTQGIQFIEKTCPGATSRFTMNFLILYSFIPALVILGIVVFKIRDHLISR
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacctctcatctttgacccccggagggtccatgggtctccaagtaaacagaggc
tcccagagctccctggagggggctcctgccaccgccccggagcctcacagcctgggcatc
ctccatgcctcctacagcgtcagccaccgcgtgaggccctggtgggacatcacatcttgc
cggcagcagtggaccaggcagatcctcaaagatgtctccttgtacgtggagagcgggcag
atcatgtgcatcctaggaagctcaggctccgggaaaaccacgctgctggacgccatgtcc
gggaggctggggcgcgcggggaccttcctgggggaggtgtatgtgaacggccgggcgctg
cgccgggagcagttccaggactgcttctcctacgtcctgcagagcgacaccctgctgagc
agcctcaccgtgcgcgagacgctgcactacaccgcgctgctggccatccgccgcggcaat
cccggctccttccagaagaaggtggaggccgtcatggcagagctgagtctgagccatgtg
gcagaccgactgattggcaactacagcttggggggcatttccacgggtgagcggcgccgg
gtctccatcgcagcccagctgctccaggatcctaaggtcatgctgtttgatgagccaacc
acaggcctggactgcatgactgctaatcagattgtcgtcctcctggtggaactggctcgc
aggaaccgaattgtggttctcaccattcaccagccccgttctgagctttttcagctcttt
gacaaaattgccatcctgagcttcggagagctgattttctgtggcacgccagcggaaatg
cttgatttcttcaatgactgcggttacccttgtcctgaacattcaaacccttttgacttc
tatatggacctgacgtcagtggatacccaaagcaaggaacgggaaatagaaacctccaag
agagtccagatgatagaatctgcctacaagaaatcagcaatttgtcataaaactttgaag
aatattgaaagaatgaaacacctgaaaacgttaccaatggttcctttcaaaaccaaagat
tctcctggagttttctctaaactgggtgttctcctgaggagagtgacaagaaacttggtg
agaaataagctggcagtgattacgcgtctccttcagaatctgatcatgggtttgttcctc
cttttcttcgttctgcgggtccgaagcaatgtgctaaagggtgctatccaggaccgcgta
ggtctcctttaccagtttgtgggcgccaccccgtacacaggcatgctgaacgctgtgaat
ctgtttcccgtgctgcgagctgtcagcgaccaggagagtcaggacggcctctaccagaag
tggcagatgatgctggcctatgcactgcacgtcctccccttcagcgttgttgccaccatg
attttcagcagtgtgtgctactggacgctgggcttacatcctgaggttgcccgatttgga
tatttttctgctgctctcttggccccccacttaattggtgaatttctaactcttgtgcta
cttggtatcgtccaaaatccaaatatagtcaacagtgtagtggctctgctgtccattgcg
ggggtgcttgttggatctggattcctcagaaacatacaagaaatgcccattccttttaaa
atcatcagttattttacattccaaaaatattgcagtgagattcttgtagtcaatgagttc
tacggactgaatttcacttgtggcagctcaaatgtttctgtgacaactaatccaatgtgt
gccttcactcaaggaattcaattcattgagaaaacctgcccaggtgcaacatctagattc
acaatgaactttctgattttgtattcatttattccagctcttgtcatcctaggaatagtt
gttttcaaaataagggatcatctcattagcaggtag

DBGET integrated database retrieval system