KEGG   Homo sapiens (human): 6445Help
Entry
6445              CDS       T01001                                 

Gene name
SGCG, 35DAG, A4, DAGA4, DMDA, DMDA1, LGMD2C, MAM, SCARMD2, SCG3, gamma-SG
Definition
(RefSeq) sarcoglycan gamma
  KO
K12564  gamma-sarcoglycan
Organism
hsa  Homo sapiens (human)
Pathway
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
hsa05416  Viral myocarditis
Disease
H00565  Sarcoglycanopathies
H00593  Limb-girdle muscular dystrophy (LGMD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    6445 (SGCG)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    6445 (SGCG)
   05414 Dilated cardiomyopathy (DCM)
    6445 (SGCG)
   05416 Viral myocarditis
    6445 (SGCG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sarcoglycan_1 DUF2345
Motif
Other DBs
NCBI-GeneID: 6445
NCBI-ProteinID: NP_000222
OMIM: 608896
HGNC: 10809
Ensembl: ENSG00000102683
Vega: OTTHUMG00000016563
Pharos: Q13326(Tbio)
UniProt: Q13326
LinkDB All DBs
Position
13q12.12
AA seq 291 aa AA seqDB search
MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKV
MWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEG
EVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVE
TPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAE
TVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHICL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgtgagcagtacactacagccacagaaggcatctgcatagagaggccagagaat
cagtatgtctacaaaattggcatttatggctggagaaagcgctgtctctacttgtttgtt
cttcttttactcatcatcctcgttgtgaatttagctcttacaatttggattcttaaagtg
atgtggttttctccagcaggaatgggccacttgtgtgtaacaaaagatggactgcgcttg
gaaggggaatcagaatttttattcccattgtatgccaaagaaatacactccagagtggac
tcatctctgcttctacaatcaacccagaatgtgactgtaaatgcgcgcaactcagaaggg
gaggtcacaggcaggttaaaagtcggtcccaaaatggtagaagtccagaatcaacagttt
cagatcaactccaacgacggcaagccactatttactgtagatgagaaggaagttgtggtt
ggtacagataaacttcgagtaactgggcctgaaggggctctttttgaacattcagtggag
acaccccttgtcagagccgacccgtttcaagaccttagattagaatcccccactcggagt
ctaagcatggatgccccaaggggtgtgcatattcaagctcacgctgggaaaattgaggcg
ctttctcaaatggatattctttttcatagtagtgatggaatgcttgtgcttgatgctgaa
actgtgtgcttacccaagctggtgcaggggacgtggggtccctctggcagctcacagagc
ctctacgaaatctgtgtgtgtccagatgggaagctgtacctgtctgtggccggtgtgagc
accacgtgccaggagcacagccacatctgcctctga

DBGET integrated database retrieval system