KEGG   Homo sapiens (human): 6448Help
Entry
6448              CDS       T01001                                 

Gene name
SGSH, HSS, MPS3A, SFMD
Definition
N-sulfoglucosamine sulfohydrolase (EC:3.10.1.1)
Orthology
K01565  
N-sulfoglucosamine sulfohydrolase [EC:3.10.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Lysosome
Module
Heparan sulfate degradation
Disease
H00130  
Mucopolysaccharidosis type III (MPS3)
H00421  
Mucopolysaccharidosis (MPS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    6448 (SGSH)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    6448 (SGSH)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.10  Acting on sulfur-nitrogen bonds
   3.10.1  Acting on sulfur-nitrogen bonds (only sub-subclass identified to date)
    3.10.1.1  N-sulfoglucosamine sulfohydrolase
     6448 (SGSH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
17q25.3
AA seq 502 aa AA seqDB search
MSCPVPACCALLLVLGLCRARPRNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLF
RNAFTSVSSCSPSRASLLTGLPQHQNGMYGLHQDVHHFNSFDKVRSLPLLLSQAGVRTGI
IGKKHVGPETVYPFDFAYTEENGSVLQVGRNITRIKLLVRKFLQTQDDRPFFLYVAFHDP
HRCGHSQPQYGTFCEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQY
TTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPLLVSSPE
HPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSLLPALEAEPLWAT
VFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMPFPIDQDFYVSPTFQDLLNRTTAGQP
TGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWV
CAPDGVLEEKLSPQCQPLHNEL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagctgccccgtgcccgcctgctgcgcgctgctgctagtcctggggctctgccgggcg
cgtccccggaacgcactgctgctcctcgcggatgacggaggctttgagagtggcgcgtac
aacaacagcgccatcgccaccccgcacctggacgccttggcccgccgcagcctcctcttt
cgcaatgccttcacctcggtcagcagctgctctcccagccgcgccagcctcctcactggc
ctgccccagcatcagaatgggatgtacgggctgcaccaggacgtgcaccacttcaactcc
ttcgacaaggtgcggagcctgccgctgctgctcagccaagctggtgtgcgcacaggcatc
atcgggaagaagcacgtggggccggagaccgtgtacccgtttgactttgcgtacacggag
gagaatggctccgtcctccaggtggggcggaacatcactagaattaagctgctcgtccgg
aaattcctgcagactcaggatgaccggcctttcttcctctacgtcgccttccacgacccc
caccgctgtgggcactcccagccccagtacggaaccttctgtgagaagtttggcaacgga
gagagcggcatgggtcgtatcccagactggaccccccaggcctacgacccactggacgtg
ctggtgccttacttcgtccccaacaccccggcagcccgagccgacctggccgctcagtac
accaccgtcggccgcatggaccaaggagttggactggtgctccaggagctgcgtgacgcc
ggtgtcctgaacgacacactggtgatcttcacgtccgacaacgggatccccttccccagc
ggcaggaccaacctgtactggccgggcactgctgaacccttactggtgtcatccccggag
cacccaaaacgctggggccaagtcagcgaggcctacgtgagcctcctagacctcacgccc
accatcttggattggttctcgatcccgtaccccagctacgccatctttggctcgaagacc
atccacctcactggccggtccctcctgccggcgctggaggccgagcccctctgggccacc
gtctttggcagccagagccaccacgaggtcaccatgtcctaccccatgcgctccgtgcag
caccggcacttccgcctcgtgcacaacctcaacttcaagatgccctttcccatcgaccag
gacttctacgtctcacccaccttccaggacctcctgaaccgcaccacagctggtcagccc
acgggctggtacaaggacctccgtcattactactaccgggcgcgctgggagctctacgac
cggagccgggacccccacgagacccagaacctggccaccgacccgcgctttgctcagctt
ctggagatgcttcgggaccagctggccaagtggcagtgggagacccacgacccctgggtg
tgcgcccccgacggcgtcctggaggagaagctctctccccagtgccagcccctccacaat
gagctgtga

DBGET integrated database retrieval system