KEGG   Homo sapiens (human): 6470Help
Entry
6470              CDS       T01001                                 

Gene name
SHMT1, CSHMT, SHMT
Definition
serine hydroxymethyltransferase 1 (soluble) (EC:2.1.2.1)
Orthology
K00600  
glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycine, serine and threonine metabolism
Cyanoamino acid metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
C1-unit interconversion, eukaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:hsa00630]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hsa00260]
Metabolism; Metabolism of other amino acids; Cyanoamino acid metabolism [PATH:hsa00460]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:hsa00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
17p11.2
AA seq 345 aa AA seqDB search
MGLDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLI
IAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKT
LRGCRAGMIFYRKGVKSVDPKTGKEILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQ
AMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLE
ACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSD
TGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPDF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggaccttccggatgggggccacctgacccatgggttcatgacagacaagaag
aaaatctctgccacgtccatcttctttgaatctatgccctacaaggtgaacccagatact
ggctacatcaactatgaccagctggaggagaacgcacgcctcttccacccgaagctgatc
atcgcaggaaccagctgctactcccgaaacctggaatatgcccggctacggaagattgca
gatgagaacggggcgtatctcatggcggacatggctcacatcagcgggctggtggcggct
ggcgtggtgccctccccatttgaacactgccatgtggtgaccaccaccactcacaagacc
ctgcgaggctgccgagctggcatgatcttctacaggaaaggagtgaaaagtgtggatccc
aagactggcaaagagattctgtacaacctggagtctcttatcaattctgctgtgttccct
ggcctgcagggaggtccccacaaccacgccattgctggggttgctgtggcactgaagcaa
gctatgactctggaatttaaagtttatcaacaccaggtggtggccaactgcagggctctg
tctgaggccctgacggagctgggctacaaaatagtcacaggtggttctgacaaccatttg
atccttgtggatctccgttccaaaggcacagatggtggaagggctgagaaggtgctagaa
gcctgttctattgcctgcaacaagaacacctgtccaggtgacagaagcgctctgcggccc
agtggactgcggctggggaccccagcactgacgtcccgtggacttttggaaaaagacttc
caaaaagtagcccactttattcacagagggatagagctgaccctgcagatccagagcgac
actggtgtcagagccaccctgaaagagttcaaggagagactggcaggggataagtaccag
gcggccgtgcaggctctccgggaggaggttgagagcttcgcctctctcttccctctgcct
ggcctgcctgacttctaa

DBGET integrated database retrieval system