KEGG   Homo sapiens (human): 6470Help
Entry
6470              CDS       T01001                                 

Gene name
SHMT1, CSHMT, SHMT
Definition
(RefSeq) serine hydroxymethyltransferase 1 (soluble) (EC:2.1.2.1)
  KO
K00600  
glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycine, serine and threonine metabolism
Cyanoamino acid metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
C1-unit interconversion, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    6470 (SHMT1)
   01230 Biosynthesis of amino acids
    6470 (SHMT1)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    6470 (SHMT1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    6470 (SHMT1)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    6470 (SHMT1)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    6470 (SHMT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     6470 (SHMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
17p11.2
AA seq 483 aa AA seqDB search
MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRA
VLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSG
SPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGY
INYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGV
VPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVKSVDPKTGKEILYNLESLINSAVFPGL
QGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLIL
VDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQK
VAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGL
PDF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgccagtcaacggggcccacaaggatgctgacctgtggtcctcacatgacaag
atgctggcacaacccctcaaagacagtgatgttgaggtttacaacatcattaagaaggag
agtaaccggcagagggttggattggagctgattgcctcggagaatttcgccagccgagca
gttttggaggccctaggctcttgcttaaataacaaatactctgaggggtacccgggccag
agatactatggcgggactgagtttattgatgaactggagaccctctgtcagaagcgagcc
ctgcaggcctataagctggacccacagtgctggggggtcaacgtccagccctactcaggc
tcccctgcaaactttgctgtgtacactgccctggtggaaccccatgggcgcatcatgggc
ctggaccttccggatgggggccacctgacccatgggttcatgacagacaagaagaaaatc
tctgccacgtccatcttctttgaatctatgccctacaaggtgaacccagatactggctac
atcaactatgaccagctggaggagaacgcacgcctcttccacccgaagctgatcatcgca
ggaaccagctgctactcccgaaacctggaatatgcccggctacggaagattgcagatgag
aacggggcgtatctcatggcggacatggctcacatcagcgggctggtggcggctggcgtg
gtgccctccccatttgaacactgccatgtggtgaccaccaccactcacaagaccctgcga
ggctgccgagctggcatgatcttctacaggaaaggagtgaaaagtgtggatcccaagact
ggcaaagagattctgtacaacctggagtctcttatcaattctgctgtgttccctggcctg
cagggaggtccccacaaccacgccattgctggggttgctgtggcactgaagcaagctatg
actctggaatttaaagtttatcaacaccaggtggtggccaactgcagggctctgtctgag
gccctgacggagctgggctacaaaatagtcacaggtggttctgacaaccatttgatcctt
gtggatctccgttccaaaggcacagatggtggaagggctgagaaggtgctagaagcctgt
tctattgcctgcaacaagaacacctgtccaggtgacagaagcgctctgcggcccagtgga
ctgcggctggggaccccagcactgacgtcccgtggacttttggaaaaagacttccaaaaa
gtagcccactttattcacagagggatagagctgaccctgcagatccagagcgacactggt
gtcagagccaccctgaaagagttcaaggagagactggcaggggataagtaccaggcggcc
gtgcaggctctccgggaggaggttgagagcttcgcctctctcttccctctgcctggcctg
cctgacttctaa

DBGET integrated database retrieval system