KEGG   Homo sapiens (human): 650Help
Entry
650               CDS       T01001                                 

Gene name
BMP2, BDA2, BMP2A
Definition
bone morphogenetic protein 2
Orthology
K04662  
bone morphogenetic protein 2/4
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Hedgehog signaling pathway
TGF-beta signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Pathways in cancer
Basal cell carcinoma
Module
BMP signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    650 (BMP2)
   04350 TGF-beta signaling pathway
    650 (BMP2)
   04390 Hippo signaling pathway
    650 (BMP2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    650 (BMP2)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    650 (BMP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    650 (BMP2)
   05217 Basal cell carcinoma
    650 (BMP2)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Morphogens (General comment) Effective diffusion, tissue differentiation, development
  650 (BMP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
20p12
AA seq 396 aa AA seqDB search
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSM
FGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEE
LPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPA
TANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVS
KRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP
LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKAC
CVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagcgttgctgcttccccaggtcctcctgggcggc
gcggctggcctcgttccggagctgggccgcaggaagttcgcggcggcgtcgtcgggccgc
ccctcatcccagccctctgacgaggtcctgagcgagttcgagttgcggctgctcagcatg
ttcggcctgaaacagagacccacccccagcagggacgccgtggtgcccccctacatgcta
gacctgtatcgcaggcactcaggtcagccgggctcacccgccccagaccaccggttggag
agggcagccagccgagccaacactgtgcgcagcttccaccatgaagaatctttggaagaa
ctaccagaaacgagtgggaaaacaacccggagattcttctttaatttaagttctatcccc
acggaggagtttatcacctcagcagagcttcaggttttccgagaacagatgcaagatgct
ttaggaaacaatagcagtttccatcaccgaattaatatttatgaaatcataaaacctgca
acagccaactcgaaattccccgtgaccagacttttggacaccaggttggtgaatcagaat
gcaagcaggtgggaaagttttgatgtcacccccgctgtgatgcggtggactgcacaggga
cacgccaaccatggattcgtggtggaagtggcccacttggaggagaaacaaggtgtctcc
aagagacatgttaggataagcaggtctttgcaccaagatgaacacagctggtcacagata
aggccattgctagtaacttttggccatgatggaaaagggcatcctctccacaaaagagaa
aaacgtcaagccaaacacaaacagcggaaacgccttaagtccagctgtaagagacaccct
ttgtacgtggacttcagtgacgtggggtggaatgactggattgtggctcccccggggtat
cacgccttttactgccacggagaatgcccttttcctctggctgatcatctgaactccact
aatcatgccattgttcagacgttggtcaactctgttaactctaagattcctaaggcatgc
tgtgtcccgacagaactcagtgctatctcgatgctgtaccttgacgagaatgaaaaggtt
gtattaaagaactatcaggacatggttgtggagggttgtgggtgtcgctag

DBGET integrated database retrieval system