KEGG   Homo sapiens (human): 650Help
Entry
650               CDS       T01001                                 

Gene name
BMP2, BDA2, BMP2A
Definition
bone morphogenetic protein 2
Orthology
K04662  
bone morphogenetic protein 2/4
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Hedgehog signaling pathway
TGF-beta signaling pathway
Hippo signaling pathway
Pathways in cancer
Basal cell carcinoma
Class
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:hsa04340]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Basal cell carcinoma [PATH:hsa05217]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
20p12
AA seq 396 aa AA seqDB search
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSM
FGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEE
LPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPA
TANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVS
KRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP
LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKAC
CVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagcgttgctgcttccccaggtcctcctgggcggc
gcggctggcctcgttccggagctgggccgcaggaagttcgcggcggcgtcgtcgggccgc
ccctcatcccagccctctgacgaggtcctgagcgagttcgagttgcggctgctcagcatg
ttcggcctgaaacagagacccacccccagcagggacgccgtggtgcccccctacatgcta
gacctgtatcgcaggcactcaggtcagccgggctcacccgccccagaccaccggttggag
agggcagccagccgagccaacactgtgcgcagcttccaccatgaagaatctttggaagaa
ctaccagaaacgagtgggaaaacaacccggagattcttctttaatttaagttctatcccc
acggaggagtttatcacctcagcagagcttcaggttttccgagaacagatgcaagatgct
ttaggaaacaatagcagtttccatcaccgaattaatatttatgaaatcataaaacctgca
acagccaactcgaaattccccgtgaccagacttttggacaccaggttggtgaatcagaat
gcaagcaggtgggaaagttttgatgtcacccccgctgtgatgcggtggactgcacaggga
cacgccaaccatggattcgtggtggaagtggcccacttggaggagaaacaaggtgtctcc
aagagacatgttaggataagcaggtctttgcaccaagatgaacacagctggtcacagata
aggccattgctagtaacttttggccatgatggaaaagggcatcctctccacaaaagagaa
aaacgtcaagccaaacacaaacagcggaaacgccttaagtccagctgtaagagacaccct
ttgtacgtggacttcagtgacgtggggtggaatgactggattgtggctcccccggggtat
cacgccttttactgccacggagaatgcccttttcctctggctgatcatctgaactccact
aatcatgccattgttcagacgttggtcaactctgttaactctaagattcctaaggcatgc
tgtgtcccgacagaactcagtgctatctcgatgctgtaccttgacgagaatgaaaaggtt
gtattaaagaactatcaggacatggttgtggagggttgtgggtgtcgctag

DBGET integrated database retrieval system