KEGG   Homo sapiens (human): 6514Help
Entry
6514              CDS       T01001                                 

Gene name
SLC2A2, GLUT2
Definition
solute carrier family 2 (facilitated glucose transporter), member 2
Orthology
K07593  
MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 2
Organism
hsa  Homo sapiens (human)
Pathway
Insulin secretion
Prolactin signaling pathway
Type II diabetes mellitus
Maturity onset diabetes of the young
Carbohydrate digestion and absorption
Disease
H00069  
Glycogen storage diseases (GSD)
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:hsa04917]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:hsa04973]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
Human Diseases; Endocrine and metabolic diseases; Maturity onset diabetes of the young [PATH:hsa04950]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
3q26.1-q26.2
AA seq 524 aa AA seqDB search
MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYV
INSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGGWLGD
TLGRIKAMLVANILSLVGALLMGFSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIA
PTALRGALGTFHQLAIVTGILISQIIGLEFILGNYDLWHILLGLSGVRAILQSLLLFFCP
ESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSY
RQPILVALMLHVAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAVNMVFTAVSVFLV
EKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFFEIGPGPIPW
FMVAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVLLAFTLFT
FFKVPETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagataaggtcactgggaccctggttttcactgtcatcactgctgtgctgggt
tccttccagtttggatatgacattggtgtgatcaatgcacctcaacaggtaataatatct
cactatagacatgttttgggtgttccactggatgaccgaaaagctatcaacaactatgtt
atcaacagtacagatgaactgcccacaatctcatactcaatgaacccaaaaccaacccct
tgggctgaggaagagactgtggcagctgctcaactaatcaccatgctctggtccctgtct
gtatccagctttgcagttggtggaatgactgcatcattctttggtgggtggcttggggac
acacttggaagaatcaaagccatgttagtagcaaacattctgtcattagttggagctctc
ttgatggggttttcaaaattgggaccatctcatatacttataattgctggaagaagcata
tcaggactatattgtgggctaatttcaggcctggttcctatgtatatcggtgaaattgct
ccaaccgctctcaggggagcacttggcacttttcatcagctggccatcgtcacgggcatt
cttattagtcagattattggtcttgaatttatcttgggcaattatgatctgtggcacatc
ctgcttggcctgtctggtgtgcgagccatccttcagtctctgctactctttttctgtcca
gaaagccccagatacctttacatcaagttagatgaggaagtcaaagcaaaacaaagcttg
aaaagactcagaggatatgatgatgtcaccaaagatattaatgaaatgagaaaagaaaga
gaagaagcatcgagtgagcagaaagtctctataattcagctcttcaccaattccagctac
cgacagcctattctagtggcactgatgctgcatgtggctcagcaattttccggaatcaat
ggcattttttactactcaaccagcatttttcagacggctggtatcagcaaacctgtttat
gcaaccattggagttggcgctgtaaacatggttttcactgctgtctctgtattccttgtg
gagaaggcagggcgacgttctctctttctaattggaatgagtgggatgtttgtttgtgcc
atcttcatgtcagtgggacttgtgctgctgaataagttctcttggatgagttatgtgagc
atgatagccatcttcctctttgtcagcttctttgaaattgggccaggcccgatcccctgg
ttcatggtggctgagtttttcagtcaaggaccacgtcctgctgctttagcaatagctgca
ttcagcaattggacctgcaatttcattgtagctctgtgtttccagtacattgcggacttc
tgtggaccttatgtgtttttcctctttgctggagtgctcctggcctttaccctgttcaca
ttttttaaagttccagaaaccaaaggaaagtcttttgaggaaattgctgcagaattccaa
aagaagagtggctcagcccacaggccaaaagctgctgtagaaatgaaattcctaggagct
acagagactgtgtaa

DBGET integrated database retrieval system