KEGG   Homo sapiens (human): 658Help
Entry
658               CDS       T01001                                 

Gene name
BMPR1B, ALK-6, ALK6, CDw293
Definition
bone morphogenetic protein receptor, type IB (EC:2.7.11.30)
Orthology
K13578  
bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Hippo signaling pathway
Disease
H00468  
Acromesomelic dysplasia with genital anomalies
H00482  
Brachydactyly
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4q22-q24
AA seq 502 aa AA seqDB search
MLLRSAGKLNVGTKKEDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEED
DSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVD
GPIHHRALLISVTVCSLLLVLIILFCYFRYKRQETRPRYSIGLEQDETYIPPGESLRDLI
EQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEAS
WFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKS
MLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFISD
TNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEVARRCVSGGIV
EEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPAS
RLTALRVKKTLAKMSESQDIKL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcttttgcgaagtgcaggaaaattaaatgtgggcaccaagaaagaggatggtgagagt
acagcccccaccccccgtccaaaggtcttgcgttgtaaatgccaccaccattgtccagaa
gactcagtcaacaatatttgcagcacagacggatattgtttcacgatgatagaagaggat
gactctgggttgcctgtggtcacttctggttgcctaggactagaaggctcagattttcag
tgtcgggacactcccattcctcatcaaagaagatcaattgaatgctgcacagaaaggaac
gaatgtaataaagacctacaccctacactgcctccattgaaaaacagagattttgttgat
ggacctatacaccacagggctttacttatatctgtgactgtctgtagtttgctcttggtc
cttatcatattattttgttacttccggtataaaagacaagaaaccagacctcgatacagc
attgggttagaacaggatgaaacttacattcctcctggagaatccctgagagacttaatt
gagcagtctcagagctcaggaagtggatcaggcctccctctgctggtccaaaggactata
gctaagcagattcagatggtgaaacagattggaaaaggtcgctatggggaagtttggatg
ggaaagtggcgtggcgaaaaggtagctgtgaaagtgttcttcaccacagaggaagccagc
tggttcagagagacagaaatatatcagacagtgttgatgaggcatgaaaacattttgggt
ttcattgctgcagatatcaaagggacagggtcctggacccagttgtacctaatcacagac
tatcatgaaaatggttccctttatgattatctgaagtccaccaccctagacgctaaatca
atgctgaagttagcctactcttctgtcagtggcttatgtcatttacacacagaaatcttt
agtactcaaggcaaaccagcaattgcccatcgagatctgaaaagtaaaaacattctggtg
aagaaaaatggaacttgctgtattgctgacctgggcctggctgttaaatttattagtgat
acaaatgaagttgacataccacctaacactcgagttggcaccaaacgctatatgcctcca
gaagtgttggacgagagcttgaacagaaatcacttccagtcttacatcatggctgacatg
tatagttttggcctcatcctttgggaggttgctaggagatgtgtatcaggaggtatagtg
gaagaataccagcttccttatcatgacctagtgcccagtgacccctcttatgaggacatg
agggagattgtgtgcatcaagaagttacgcccctcattcccaaaccggtggagcagtgat
gagtgtctaaggcagatgggaaaactcatgacagaatgctgggctcacaatcctgcatca
aggctgacagccctgcgggttaagaaaacacttgccaaaatgtcagagtcccaggacatt
aaactctga

DBGET integrated database retrieval system