KEGG   Homo sapiens (human): 6591Help
Entry
6591              CDS       T01001                                 

Gene name
SNAI2, SLUG, SLUGH, SLUGH1, SNAIL2, WS2D
Definition
(RefSeq) snail family transcriptional repressor 2
  KO
K05706  snail 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
Disease
H00170  Piebaldism
H00759  Waardenburg syndrome (WS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    6591 (SNAI2)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    6591 (SNAI2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    6591 (SNAI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-met zf-Di19 zf-BED zf-C2HC_2 zinc_ribbon_15 Elf1 Zn-ribbon_8 zf-H2C2_5 Ogr_Delta KCNQ2_u3 Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 6591
NCBI-ProteinID: NP_003059
OMIM: 602150
HGNC: 11094
Ensembl: ENSG00000019549
Vega: OTTHUMG00000149912
Pharos: O43623(Tbio)
UniProt: O43623
LinkDB All DBs
Position
8q11.21
AA seq 268 aa AA seqDB search
MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWT
TAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP
HAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT
HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK
YQCKNCSKTFSRMSLLHKHEESGCCVAH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctccttcctggtcaagaagcatttcaacgcctccaaaaagccaaactacagc
gaactggacacacatacagtgattatttccccgtatctctatgagagttactccatgcct
gtcataccacaaccagagatcctcagctcaggagcatacagccccatcactgtgtggact
accgctgctccattccacgcccagctacccaatggcctctctcctctttccggatactcc
tcatctttggggcgagtgagtccccctcctccatctgacacctcctccaaggaccacagt
ggctcagaaagccccattagtgatgaagaggaaagactacagtccaagctttcagacccc
catgccattgaagctgaaaagtttcagtgcaatttatgcaataagacctattcaactttt
tctgggctggccaaacataagcagctgcactgcgatgcccagtctagaaaatctttcagc
tgtaaatactgtgacaaggaatatgtgagcctgggcgccctgaagatgcatattcggacc
cacacattaccttgtgtttgcaagatctgcggcaaggcgttttccagaccctggttgctt
caaggacacattagaactcacacgggggagaagcctttttcttgccctcactgcaacaga
gcatttgcagacaggtcaaatctgagggctcatctgcagacccattctgatgtaaagaaa
taccagtgcaaaaactgctccaaaaccttctccagaatgtctctcctgcacaaacatgag
gaatctggctgctgtgtagcacactga

DBGET integrated database retrieval system