KEGG   Homo sapiens (human): 6591Help
Entry
6591              CDS       T01001                                 

Gene name
SNAI2, SLUG, SLUGH1, SNAIL2, WS2D
Definition
snail family zinc finger 2
Orthology
K05706  
snail 2
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Adherens junction
Disease
H00170  
Piebaldism
H00759  
Waardenburg syndrome (WS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    6591 (SNAI2)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    6591 (SNAI2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    6591 (SNAI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
8q11
AA seq 268 aa AA seqDB search
MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWT
TAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP
HAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT
HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK
YQCKNCSKTFSRMSLLHKHEESGCCVAH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctccttcctggtcaagaagcatttcaacgcctccaaaaagccaaactacagc
gaactggacacacatacagtgattatttccccgtatctctatgagagttactccatgcct
gtcataccacaaccagagatcctcagctcaggagcatacagccccatcactgtgtggact
accgctgctccattccacgcccagctacccaatggcctctctcctctttccggatactcc
tcatctttggggcgagtgagtccccctcctccatctgacacctcctccaaggaccacagt
ggctcagaaagccccattagtgatgaagaggaaagactacagtccaagctttcagacccc
catgccattgaagctgaaaagtttcagtgcaatttatgcaataagacctattcaactttt
tctgggctggccaaacataagcagctgcactgcgatgcccagtctagaaaatctttcagc
tgtaaatactgtgacaaggaatatgtgagcctgggcgccctgaagatgcatattcggacc
cacacattaccttgtgtttgcaagatctgcggcaaggcgttttccagaccctggttgctt
caaggacacattagaactcacacgggggagaagcctttttcttgccctcactgcaacaga
gcatttgcagacaggtcaaatctgagggctcatctgcagacccattctgatgtaaagaaa
taccagtgcaaaaactgctccaaaaccttctccagaatgtctctcctgcacaaacatgag
gaatctggctgctgtgtagcacactga

DBGET integrated database retrieval system