KEGG   Homo sapiens (human): 6622Help
Entry
6622              CDS       T01001                                 

Gene name
SNCA, NACP, PARK1, PARK4, PD1
Definition
(RefSeq) synuclein alpha
  KO
K04528  
alpha-synuclein
Organism
hsa  Homo sapiens (human)
Pathway
Alzheimer's disease
Parkinson's disease
Disease
H00057  
Parkinson's disease (PD)
H00066  
Lewy body dementia (LBD)
H01600  
Parkinsonian syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    6622 (SNCA)
   05012 Parkinson's disease
    6622 (SNCA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4q21
AA seq 140 aa AA seqDB search
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggatgtattcatgaaaggactttcaaaggccaaggagggagttgtggctgctgctgag
aaaaccaaacagggtgtggcagaagcagcaggaaagacaaaagagggtgttctctatgta
ggctccaaaaccaaggagggagtggtgcatggtgtggcaacagtggctgagaagaccaaa
gagcaagtgacaaatgttggaggagcagtggtgacgggtgtgacagcagtagcccagaag
acagtggagggagcagggagcattgcagcagccactggctttgtcaaaaaggaccagttg
ggcaagaatgaagaaggagccccacaggaaggaattctggaagatatgcctgtggatcct
gacaatgaggcttatgaaatgccttctgaggaagggtatcaagactacgaacctgaagcc
taa

DBGET integrated database retrieval system