KEGG   Homo sapiens (human): 6626Help
Entry
6626              CDS       T01001                                 

Gene name
SNRPA, Mud1, U1-A, U1A
Definition
small nuclear ribonucleoprotein polypeptide A
Orthology
K11091  
U1 small nuclear ribonucleoprotein A
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U1-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6626 (SNRPA)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   U1 snRNP specific factors
    6626 (SNRPA)
 Complex B
    6626 (SNRPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
19q13.1
AA seq 282 aa AA seqDB search
MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFK
EVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPA
TKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQI
PPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV
PGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcccgagacccgccctaaccacactatttatatcaacaacctcaatgagaag
atcaagaaggatgagctaaaaaagtccctgtacgccatcttctcccagtttggccagatc
ctggatatcctggtatcacggagcctgaagatgaggggccaggcctttgtcatcttcaag
gaggtcagcagcgccaccaacgccctgcgctccatgcagggtttccctttctatgacaaa
cctatgcgtatccagtatgccaagaccgactcagatatcattgccaagatgaaaggcacc
ttcgtggagcgggaccgcaagcgggagaagaggaagcccaagagccaggagaccccggcc
accaagaaggctgtgcaaggcgggggagccacccccgtggtgggggctgtccaggggcct
gtcccgggcatgccgccgatgactcaggcgccccgcattatgcaccacatgccgggccag
ccgccctacatgccgccccctggtatgatccccccgccaggccttgcacctggccagatc
ccaccaggggccatgcccccgcagcagcttatgccaggacagatgccccctgcccagcct
ctttctgagaatccaccgaatcacatcttgttcctcaccaacctgccagaggagaccaac
gagctcatgctgtccatgcttttcaatcagttccctggcttcaaggaggtccgtctggta
cccgggcggcatgacatcgccttcgtggagtttgacaatgaggtacaggcaggggcagct
cgcgatgccctgcagggctttaagatcacgcagaacaacgccatgaagatctcctttgcc
aagaagtag

DBGET integrated database retrieval system