KEGG   Homo sapiens (human): 672Help
Entry
672               CDS       T01001                                 

Gene name
BRCA1, BRCAI, BRCC1, BROVCA1, IRIS, PNCA4, PPP1R53, PSCP, RNF53
Definition
breast cancer 1, early onset
Orthology
K10605  
breast cancer type 1 susceptibility protein
Organism
hsa  Homo sapiens (human)
Pathway
Fanconi anemia pathway
Ubiquitin mediated proteolysis
PI3K-Akt signaling pathway
MicroRNAs in cancer
Module
BRCA1-associated genome surveillance complex (BASC)
Disease
H00027  
Ovarian cancer
H00031  
Breast cancer
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:hsa03460]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
17q21
AA seq 1863 aa AA seqDB search
MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKD
EVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYI
ELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQ
PSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVE
KAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPC
SENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVD
EYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTEN
LIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTE
QNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNI
HNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPV
RHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKE
FVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQ
ESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHS
RETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVT
FECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRG
NETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIP
STVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKL
NAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSS
HASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQ
GYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENL
LSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGS
SKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSE
DCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALE
DLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSK
CPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEG
TPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTT
DTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLI
TEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDV
VNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTL
GTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPH
SHY
NT seq 5592 nt NT seq  +upstreamnt  +downstreamnt
atggatttatctgctcttcgcgttgaagaagtacaaaatgtcattaatgctatgcagaaa
atcttagagtgtcccatctgtctggagttgatcaaggaacctgtctccacaaagtgtgac
cacatattttgcaaattttgcatgctgaaacttctcaaccagaagaaagggccttcacag
tgtcctttatgtaagaatgatataaccaaaaggagcctacaagaaagtacgagatttagt
caacttgttgaagagctattgaaaatcatttgtgcttttcagcttgacacaggtttggag
tatgcaaacagctataattttgcaaaaaaggaaaataactctcctgaacatctaaaagat
gaagtttctatcatccaaagtatgggctacagaaaccgtgccaaaagacttctacagagt
gaacccgaaaatccttccttgcaggaaaccagtctcagtgtccaactctctaaccttgga
actgtgagaactctgaggacaaagcagcggatacaacctcaaaagacgtctgtctacatt
gaattgggatctgattcttctgaagataccgttaataaggcaacttattgcagtgtggga
gatcaagaattgttacaaatcacccctcaaggaaccagggatgaaatcagtttggattct
gcaaaaaaggctgcttgtgaattttctgagacggatgtaacaaatactgaacatcatcaa
cccagtaataatgatttgaacaccactgagaagcgtgcagctgagaggcatccagaaaag
tatcagggtagttctgtttcaaacttgcatgtggagccatgtggcacaaatactcatgcc
agctcattacagcatgagaacagcagtttattactcactaaagacagaatgaatgtagaa
aaggctgaattctgtaataaaagcaaacagcctggcttagcaaggagccaacataacaga
tgggctggaagtaaggaaacatgtaatgataggcggactcccagcacagaaaaaaaggta
gatctgaatgctgatcccctgtgtgagagaaaagaatggaataagcagaaactgccatgc
tcagagaatcctagagatactgaagatgttccttggataacactaaatagcagcattcag
aaagttaatgagtggttttccagaagtgatgaactgttaggttctgatgactcacatgat
ggggagtctgaatcaaatgccaaagtagctgatgtattggacgttctaaatgaggtagat
gaatattctggttcttcagagaaaatagacttactggccagtgatcctcatgaggcttta
atatgtaaaagtgaaagagttcactccaaatcagtagagagtaatattgaagacaaaata
tttgggaaaacctatcggaagaaggcaagcctccccaacttaagccatgtaactgaaaat
ctaattataggagcatttgttactgagccacagataatacaagagcgtcccctcacaaat
aaattaaagcgtaaaaggagacctacatcaggccttcatcctgaggattttatcaagaaa
gcagatttggcagttcaaaagactcctgaaatgataaatcagggaactaaccaaacggag
cagaatggtcaagtgatgaatattactaatagtggtcatgagaataaaacaaaaggtgat
tctattcagaatgagaaaaatcctaacccaatagaatcactcgaaaaagaatctgctttc
aaaacgaaagctgaacctataagcagcagtataagcaatatggaactcgaattaaatatc
cacaattcaaaagcacctaaaaagaataggctgaggaggaagtcttctaccaggcatatt
catgcgcttgaactagtagtcagtagaaatctaagcccacctaattgtactgaattgcaa
attgatagttgttctagcagtgaagagataaagaaaaaaaagtacaaccaaatgccagtc
aggcacagcagaaacctacaactcatggaaggtaaagaacctgcaactggagccaagaag
agtaacaagccaaatgaacagacaagtaaaagacatgacagcgatactttcccagagctg
aagttaacaaatgcacctggttcttttactaagtgttcaaataccagtgaacttaaagaa
tttgtcaatcctagccttccaagagaagaaaaagaagagaaactagaaacagttaaagtg
tctaataatgctgaagaccccaaagatctcatgttaagtggagaaagggttttgcaaact
gaaagatctgtagagagtagcagtatttcattggtacctggtactgattatggcactcag
gaaagtatctcgttactggaagttagcactctagggaaggcaaaaacagaaccaaataaa
tgtgtgagtcagtgtgcagcatttgaaaaccccaagggactaattcatggttgttccaaa
gataatagaaatgacacagaaggctttaagtatccattgggacatgaagttaaccacagt
cgggaaacaagcatagaaatggaagaaagtgaacttgatgctcagtatttgcagaataca
ttcaaggtttcaaagcgccagtcatttgctccgttttcaaatccaggaaatgcagaagag
gaatgtgcaacattctctgcccactctgggtccttaaagaaacaaagtccaaaagtcact
tttgaatgtgaacaaaaggaagaaaatcaaggaaagaatgagtctaatatcaagcctgta
cagacagttaatatcactgcaggctttcctgtggttggtcagaaagataagccagttgat
aatgccaaatgtagtatcaaaggaggctctaggttttgtctatcatctcagttcagaggc
aacgaaactggactcattactccaaataaacatggacttttacaaaacccatatcgtata
ccaccactttttcccatcaagtcatttgttaaaactaaatgtaagaaaaatctgctagag
gaaaactttgaggaacattcaatgtcacctgaaagagaaatgggaaatgagaacattcca
agtacagtgagcacaattagccgtaataacattagagaaaatgtttttaaagaagccagc
tcaagcaatattaatgaagtaggttccagtactaatgaagtgggctccagtattaatgaa
ataggttccagtgatgaaaacattcaagcagaactaggtagaaacagagggccaaaattg
aatgctatgcttagattaggggttttgcaacctgaggtctataaacaaagtcttcctgga
agtaattgtaagcatcctgaaataaaaaagcaagaatatgaagaagtagttcagactgtt
aatacagatttctctccatatctgatttcagataacttagaacagcctatgggaagtagt
catgcatctcaggtttgttctgagacacctgatgacctgttagatgatggtgaaataaag
gaagatactagttttgctgaaaatgacattaaggaaagttctgctgtttttagcaaaagc
gtccagaaaggagagcttagcaggagtcctagccctttcacccatacacatttggctcag
ggttaccgaagaggggccaagaaattagagtcctcagaagagaacttatctagtgaggat
gaagagcttccctgcttccaacacttgttatttggtaaagtaaacaatataccttctcag
tctactaggcatagcaccgttgctaccgagtgtctgtctaagaacacagaggagaattta
ttatcattgaagaatagcttaaatgactgcagtaaccaggtaatattggcaaaggcatct
caggaacatcaccttagtgaggaaacaaaatgttctgctagcttgttttcttcacagtgc
agtgaattggaagacttgactgcaaatacaaacacccaggatcctttcttgattggttct
tccaaacaaatgaggcatcagtctgaaagccagggagttggtctgagtgacaaggaattg
gtttcagatgatgaagaaagaggaacgggcttggaagaaaataatcaagaagagcaaagc
atggattcaaacttaggtgaagcagcatctgggtgtgagagtgaaacaagcgtctctgaa
gactgctcagggctatcctctcagagtgacattttaaccactcagcagagggataccatg
caacataacctgataaagctccagcaggaaatggctgaactagaagctgtgttagaacag
catgggagccagccttctaacagctacccttccatcataagtgactcttctgcccttgag
gacctgcgaaatccagaacaaagcacatcagaaaaagcagtattaacttcacagaaaagt
agtgaataccctataagccagaatccagaaggcctttctgctgacaagtttgaggtgtct
gcagatagttctaccagtaaaaataaagaaccaggagtggaaaggtcatccccttctaaa
tgcccatcattagatgataggtggtacatgcacagttgctctgggagtcttcagaataga
aactacccatctcaagaggagctcattaaggttgttgatgtggaggagcaacagctggaa
gagtctgggccacacgatttgacggaaacatcttacttgccaaggcaagatctagaggga
accccttacctggaatctggaatcagcctcttctctgatgaccctgaatctgatccttct
gaagacagagccccagagtcagctcgtgttggcaacataccatcttcaacctctgcattg
aaagttccccaattgaaagttgcagaatctgcccagagtccagctgctgctcatactact
gatactgctgggtataatgcaatggaagaaagtgtgagcagggagaagccagaattgaca
gcttcaacagaaagggtcaacaaaagaatgtccatggtggtgtctggcctgaccccagaa
gaatttatgctcgtgtacaagtttgccagaaaacaccacatcactttaactaatctaatt
actgaagagactactcatgttgttatgaaaacagatgctgagtttgtgtgtgaacggaca
ctgaaatattttctaggaattgcgggaggaaaatgggtagttagctatttctgggtgacc
cagtctattaaagaaagaaaaatgctgaatgagcatgattttgaagtcagaggagatgtg
gtcaatggaagaaaccaccaaggtccaaagcgagcaagagaatcccaggacagaaagatc
ttcagggggctagaaatctgttgctatgggcccttcaccaacatgcccacagatcaactg
gaatggatggtacagctgtgtggtgcttctgtggtgaaggagctttcatcattcaccctt
ggcacaggtgtccacccaattgtggttgtgcagccagatgcctggacagaggacaatggc
ttccatgcaattgggcagatgtgtgaggcacctgtggtgacccgagagtgggtgttggac
agtgtagcactctaccagtgccaggagctggacacctacctgataccccagatcccccac
agccactactga

DBGET integrated database retrieval system