KEGG   Homo sapiens (human): 6775Help
Entry
6775              CDS       T01001                                 

Gene name
STAT4, SLEB11
Definition
(RefSeq) signal transducer and activator of transcription 4
  KO
K11222  
signal transducer and activator of transcription 4
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Th1 and Th2 cell differentiation
Hepatitis B
Inflammatory bowel disease (IBD)
Module
JAK-STAT signaling
Disease
H01492  
Systemic sclerosis
H01502  
Sjogren's Syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    6775 (STAT4)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    6775 (STAT4)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    6775 (STAT4)
  Infectious diseases
   05161 Hepatitis B
    6775 (STAT4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6775 (STAT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
2q32.2-q32.3
AA seq 748 aa AA seqDB search
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDLLMNTMLIEELQDWKR
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRTHM
LERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCH
MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL
VFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCK
EHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPM
SPSVYAVLRENLSPTTIETAMKSPYSAE
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtggaatcaagtccaacagttagaaatcaagtttttggagcaggtggatcaa
ttctatgatgacaactttcccatggaaattcggcatctgttggcccaatggattgaaaat
caagactgggaggcagcttctaacaatgaaaccatggcaacgattcttcttcaaaacttg
ttaatacaactggatgaacagttaggtcgtgtttccaaagagaaaaacctactcttgata
cacaatctaaaaagaattaggaaggtccttcagggaaaatttcatggaaatccaatgcat
gtagctgtggttatttcaaactgtttaagggaagagaggagaatattggctgcagccaac
atgcctgtccaggggcctctagagaaatccttacaaagttcttcagtttcagaaagacag
aggaatgtggagcacaaagtggctgccattaaaaacagtgtgcagatgacagaacaagat
accaaatacttagaagatctgcaagacgaatttgactacaggtataaaacaattcagaca
atggatcagagtgacaagaatagtgccatggtgaatcaggaagttttgacactgcaggaa
atgcttaacagcctcgatttcaagagaaaggaggctctcagtaaaatgacccaaatcatc
catgagacagacctgttaatgaacaccatgctcatagaagagctgcaagactggaagcgg
cggcagcaaatcgcctgcatcgggggtccactccacaatgggctcgaccagcttcagaac
tgctttacactattggcagaaagtcttttccaactgagaaggcaattggagaaactagag
gagcaatctaccaaaatgacatatgaaggtgatcccattccaatgcaaagaactcacatg
ctagaaagagtcaccttcttgatctacaaccttttcaagaactcatttgtggttgagcga
cagccatgtatgccaacccaccctcagaggccgttggtacttaaaaccctaattcagttc
actgtaaaactaaggctactaataaaattgccagaactaaactatcaggtaaaggttaag
gcatcaattgacaagaatgtttcaactctaagcaaccgaagatttgtactttgtggaact
aatgtcaaagccatgtctattgaagaatcttccaatgggagtctctcagtagaatttcga
catttgcaaccaaaggaaatgaagtccagtgctggaggtaaaggaaatgagggctgtcac
atggtgactgaagaacttcattccataacgtttgaaacacagatctgcctctatggcctg
accatagatttggagaccagctcattgcctgtggtgatgatttccaatgtcagtcagtta
cctaatgcttgggcatccatcatttggtacaacgtgtcaaccaacgattcccagaacttg
gttttctttaataatcctccacctgccacattgagtcaactactggaggtgatgagctgg
cagttttcatcgtacgttggtcgtggtcttaactcagatcaactccatatgctggcagag
aagcttacagtccaatctagctacagtgatggtcacctcacctgggccaagttctgcaag
gaacatttacctggtaaatcatttaccttttggacatggcttgaagcaatattggatcta
attaagaaacacattcttcccctttggattgatgggtatgtcatgggctttgttagcaaa
gagaaggaacggctgttgctaaaggataaaatgcctggcacctttttattaagattcagt
gaaagccatctcggaggaataactttcacctgggtggaccattctgaaagtggggaagtg
agattccactctgtagaaccctacaataaaggccggttgtctgctctgccattcgctgac
atcctgcgagactacaaagttattatggctgaaaacattcctgaaaaccctctgaagtac
ctatatcctgacattcccaaagacaaagccttcggtaaacactacagctctcagccttgc
gaagtttcaagaccaacagaaaggggtgacaaaggttatgttccttctgtttttatcccc
atctcaacaatccgaagtgattcaacagagccacattctccatcagaccttcttcccatg
tctccaagtgtgtatgcggtgttgagagaaaacctgagtcccacaacaattgaaactgca
atgaagtctccttattctgctgaatga

DBGET integrated database retrieval system