KEGG   Homo sapiens (human): 6794Help
Entry
6794              CDS       T01001                                 

Gene name
STK11, LKB1, PJS, hLKB1
Definition
(RefSeq) serine/threonine kinase 11 (EC:2.7.11.1)
  KO
K07298  
serine/threonine-protein kinase 11
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway - mammal
Adipocytokine signaling pathway
Disease
H00019  
Pancreatic cancer
H00666  
Peutz-Jeghers syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    6794 (STK11)
   04151 PI3K-Akt signaling pathway
    6794 (STK11)
   04152 AMPK signaling pathway
    6794 (STK11)
   04150 mTOR signaling pathway
    6794 (STK11)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    6794 (STK11)
  Aging
   04211 Longevity regulating pathway - mammal
    6794 (STK11)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   6794 (STK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 433 aa AA seqDB search
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPG
NLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSI
RQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDI
IYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA
SSKIRRLSACKQQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggtggacccgcagcagctgggcatgttcacggagggcgagctgatgtcggtg
ggtatggacacgttcatccaccgcatcgactccaccgaggtcatctaccagccgcgccgc
aagcgggccaagctcatcggcaagtacctgatgggggacctgctgggggaaggctcttac
ggcaaggtgaaggaggtgctggactcggagacgctgtgcaggagggccgtcaagatcctc
aagaagaagaagttgcgaaggatccccaacggggaggccaacgtgaagaaggaaattcaa
ctactgaggaggttacggcacaaaaatgtcatccagctggtggatgtgttatacaacgaa
gagaagcagaaaatgtatatggtgatggagtactgcgtgtgtggcatgcaggaaatgctg
gacagcgtgccggagaagcgtttcccagtgtgccaggcccacgggtacttctgtcagctg
attgacggcctggagtacctgcatagccagggcattgtgcacaaggacatcaagccgggg
aacctgctgctcaccaccggtggcaccctcaaaatctccgacctgggcgtggccgaggca
ctgcacccgttcgcggcggacgacacctgccggaccagccagggctccccggctttccag
ccgcccgagattgccaacggcctggacaccttctccggcttcaaggtggacatctggtcg
gctggggtcaccctctacaacatcaccacgggtctgtaccccttcgaaggggacaacatc
tacaagttgtttgagaacatcgggaaggggagctacgccatcccgggcgactgtggcccc
ccgctctctgacctgctgaaagggatgcttgagtacgaaccggccaagaggttctccatc
cggcagatccggcagcacagctggttccggaagaaacatcctccggctgaagcaccagtg
cccatcccaccgagcccagacaccaaggaccggtggcgcagcatgactgtggtgccgtac
ttggaggacctgcacggcgcggacgaggacgaggacctcttcgacatcgaggatgacatc
atctacactcaggacttcacggtgcccggacaggtcccagaagaggaggccagtcacaat
ggacagcgccggggcctccccaaggccgtgtgtatgaacggcacagaggcggcgcagctg
agcaccaaatccagggcggagggccgggcccccaaccctgcccgcaaggcctgctccgcc
agcagcaagatccgccggctgtcggcctgcaagcagcagtga

DBGET integrated database retrieval system