KEGG   Homo sapiens (human): 6868Help
Entry
6868              CDS       T01001                                 

Gene name
ADAM17, ADAM18, CD156B, CSVP, NISBD, TACE
Definition
ADAM metallopeptidase domain 17 (EC:3.4.24.86)
Orthology
K06059  
disintegrin and metalloproteinase domain-containing protein 17 [EC:3.4.24.86]
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Alzheimer's disease
Epithelial cell signaling in Helicobacter pylori infection
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    6868 (ADAM17)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    6868 (ADAM17)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6868 (ADAM17)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.86  ADAM 17 endopeptidase
     6868 (ADAM17)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   6868 (ADAM17)
Cellular antigens [BR:hsa04090]
 Proteins
  6868 (ADAM17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2p25
AA seq 824 aa AA seqDB search
MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDL
QTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVV
GEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQS
PKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYRYMG
RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNM
AKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS
HGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN
SRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINA
TCKGVSYCTGNSSECPPPGNAEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSC
KVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS
INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHPSNVEMLSSMD
SASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKD
PFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagtctctcctattcctgaccagcgtggttcctttcgtgctggcgccgcgacct
ccggatgacccgggcttcggcccccaccagagactcgagaagcttgattctttgctctca
gactacgatattctctctttatctaatatccagcagcattcggtaagaaaaagagatcta
cagacttcaacacatgtagaaacactactaactttttcagctttgaaaaggcattttaaa
ttatacctgacatcaagtactgaacgtttttcacaaaatttcaaggtcgtggtggtggat
ggtaaaaacgaaagcgagtacactgtaaaatggcaggacttcttcactggacacgtggtt
ggtgagcctgactctagggttctagcccacataagagatgatgatgttataatcagaatc
aacacagatggggccgaatataacatagagccactttggagatttgttaatgataccaaa
gacaaaagaatgttagtttataaatctgaagatatcaagaatgtttcacgtttgcagtct
ccaaaagtgtgtggttatttaaaagtggataatgaagagttgctcccaaaagggttagta
gacagagaaccacctgaagagcttgttcatcgagtgaaaagaagagctgacccagatccc
atgaagaacacgtgtaaattattggtggtagcagatcatcgcttctacagatacatgggc
agaggggaagagagtacaactacaaattacttaatagagctaattgacagagttgatgac
atctatcggaacacttcatgggataatgcaggttttaaaggctatggaatacagatagag
cagattcgcattctcaagtctccacaagaggtaaaacctggtgaaaagcactacaacatg
gcaaaaagttacccaaatgaagaaaaggatgcttgggatgtgaagatgttgctagagcaa
tttagctttgatatagctgaggaagcatctaaagtttgcttggcacaccttttcacatac
caagattttgatatgggaactcttggattagcttatgttggctctcccagagcaaacagc
catggaggtgtttgtccaaaggcttattatagcccagttgggaagaaaaatatctatttg
aatagtggtttgacgagcacaaagaattatggtaaaaccatccttacaaaggaagctgac
ctggttacaactcatgaattgggacataattttggagcagaacatgatccggatggtcta
gcagaatgtgccccgaatgaggaccagggagggaaatatgtcatgtatcccatagctgtg
agtggcgatcacgagaacaataagatgttttcaaactgcagtaaacaatcaatctataag
accattgaaagtaaggcccaggagtgttttcaagaacgcagcaataaagtttgtgggaac
tcgagggtggatgaaggagaagagtgtgatcctggcatcatgtatctgaacaacgacacc
tgctgcaacagcgactgcacgttgaaggaaggtgtccagtgcagtgacaggaacagtcct
tgctgtaaaaactgtcagtttgagactgcccagaagaagtgccaggaggcgattaatgct
acttgcaaaggcgtgtcctactgcacaggtaatagcagtgagtgcccgcctccaggaaat
gctgaagatgacactgtttgcttggatcttggcaagtgtaaggatgggaaatgcatccct
ttctgcgagagggaacagcagctggagtcctgtgcatgtaatgaaactgacaactcctgc
aaggtgtgctgcagggacctttctggccgctgtgtgccctatgtcgatgctgaacaaaag
aacttatttttgaggaaaggaaagccctgtacagtaggattttgtgacatgaatggcaaa
tgtgagaaacgagtacaggatgtaattgaacgattttgggatttcattgaccagctgagc
atcaatacttttggaaagtttttagcagacaacatcgttgggtctgtcctggttttctcc
ttgatattttggattcctttcagcattcttgtccattgtgtggataagaaattggataaa
cagtatgaatctctgtctctgtttcaccccagtaacgtcgaaatgctgagcagcatggat
tctgcatcggttcgcattatcaaaccctttcctgcgccccagactccaggccgcctgcag
cctgcccctgtgatcccttcggcgccagcagctccaaaactggaccaccagagaatggac
accatccaggaagaccccagcacagactcacatatggacgaggatgggtttgagaaggac
cccttcccaaatagcagcacagctgccaagtcatttgaggatctcacggaccatccggtc
accagaagtgaaaaggctgcctcctttaaactgcagcgtcagaatcgtgttgacagcaaa
gaaacagagtgctaa

DBGET integrated database retrieval system